Recombinant Human FGFR1 Protein
Beta LifeScience
SKU/CAT #: BLA-1455P
Recombinant Human FGFR1 Protein
Beta LifeScience
SKU/CAT #: BLA-1455P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P11362-7 |
Synonym | Basic fibroblast growth factor receptor 1 bFGF-R-1 BFGFR CD331 CEK FGFBR FGFR 1 FGFR-1 FGFR1 FGFR1/PLAG1 fusion FGFR1_HUMAN fibroblast growth factor receptor 1 FLG FLT-2 FLT2 Fms-like gene Fms-like tyrosine kinase 2 fms-related tyrosine kinase 2 HBGFR heparin-binding growth factor receptor HH2 HRTFDS hydroxyaryl-protein kinase KAL2 N-SAM OGD Proto-oncogene c-Fgr |
Description | Recombinant Human FGFR1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGV QLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDA LPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKT VKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATGSIIMDSVVPS DKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNV EFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEM EVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPL YLEII |
Molecular Weight | 42 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. |