Recombinant Human FGFR2 (mutated V564 F) Protein
Beta LifeScience
SKU/CAT #: BLA-1475P
Recombinant Human FGFR2 (mutated V564 F) Protein
Beta LifeScience
SKU/CAT #: BLA-1475P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P21802-20 |
Synonym | bacteria-expressed kinase BBDS BEK BEK fibroblast growth factor receptor BFR1 CD332 CD332 antigen CEK3 CFD1 Craniofacial dysostosis 1 ECT1 FGF receptor FGFR 2 FGFR-2 Fgfr2 FGFR2_HUMAN Fibroblast growth factor receptor 2 Hydroxyaryl protein kinase Jackson Weiss syndrome JWS K SAM K-sam Keratinocyte growth factor receptor Keratinocyte growth factor receptor 2 KGFR KSAM protein tyrosine kinase, receptor like 14 soluble FGFR4 variant 4 TK14 TK25 |
Description | Recombinant Human FGFR2 (mutated V564 F) Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | RMKNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTR LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEA VGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINL LGACTQDGPLYVIFEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARD INNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLG GSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTF KQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSP DPMPYEPCLPQYPHINGSVKT |
Molecular Weight | 74 kDa including tags |
Purity | >85% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity of this protein was determined to be 260 nmol/min/mg |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |