Recombinant Human FGFRL1 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-1494P

Recombinant Human FGFRL1 Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-1494P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q8N441
Synonym FGF homologous factor receptor FGF receptor like protein 1 FGF receptor-like protein 1 FGFR 5 FGFR like protein FGFR-5 FGFR-like protein FGFR5 Fgfrl1 FGRL1_HUMAN FHFR Fibroblast growth factor receptor 5 Fibroblast growth factor receptor like 1 Fibroblast growth factor receptor-like 1
Description Recombinant Human FGFRL1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence ARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGW SRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGK ESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVA SGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVS NRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDV KPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL ITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATS LPWP
Molecular Weight 66 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Measured by its bind this protein with a linear range of 0.16 - 2 μg/ml.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Please see notes section.

Target Details

Target Function Has a negative effect on cell proliferation.
Subcellular Location Membrane; Single-pass type I membrane protein. Note=Predominantly localized in the plasma membrane but also detected in the Golgi and in secretory vesicles.
Database References
Tissue Specificity Expressed preferentially in cartilaginous tissues and pancreas. Highly expressed in the liver, kidney, heart, brain and skeletal muscle. Weakly expressed in the lung, small intestine and spleen.

Gene Functions References

  1. this study shows FGFRL1 promotes ovarian cancer progression by crosstalk with Hedgehog signaling PMID: 29675438
  2. FGFRL1 is a transmembrane receptor that can induce the fusion of CHO cells to multinucleated syncytia. This cell fusion activity has been attributed to the extracellular Ig3 domain of the receptor. The Ig3 domain from humans, mice, chicken and fish stimulates fusion of CHO cells, while the Ig3 domain from lancelet and sea urchin does not. PMID: 28596102
  3. Both in vitro and in vivo studies determined that miR-210 promoted hepatocellular carcinoma (HCC), angiogenesis, and the corresponding mechanism was identified to be the direct targeting and inhibition of fibroblast growth factor receptor-like 1 (FGFRL1) expression PMID: 27666683
  4. FGFRL1 is a cell adhesion protein. PMID: 27220341
  5. functional evidence for a novel FGFRL1 poly-miRTS rs4647940 in a previously known 4p16.3 locus, and experimental and clinical genetics studies have shown both FGFRL1 and hsa-miR-140-5p are important for bone formation. PMID: 25941324
  6. Cell-cell fusion induced by the Ig3 domain of receptor FGFRL1 PMID: 26025674
  7. The signaling complex appears to integrate the input from FGFR and EphA4, and release the output signal through FRS2alpha. PMID: 20184660
  8. study identified a novel region of deletion mapping to 4p16.3 in 15 percent of bladder tumors and 24 percent of bladder cancer cell lines; FGFRL1, which maps within this region, was investigated as putative deletion target; average FGFRL1 protein expression was lower in bladder tumors compared to normal tissue, but downregulation was independent from 4p16.3 LOH status PMID: 23775577
  9. Interaction of FGFRL1 with Spred1 increases the proportion of the receptor at the plasma membrane. PMID: 21616146
  10. an important role for miR-210 as a tumor-suppressive microRNA with effects on cancer cell proliferation PMID: 21044961
  11. FGFRL1 is capable of inducing syncytium formation of heterologous cells in vitro. PMID: 20851884
  12. FGFRL1 is indeed a decoy receptor for FGFs. PMID: 19920134
  13. analysis of FGF18 and FGFR5(FGFRL1) expression in primary endothelial cells and vascular smooth muscle cells PMID: 16019430
  14. Screening of 241 different human tumors with the help of a cancer profiling array suggested major alterations in the relative expression of FGFRL1 in ovarian tumors PMID: 16273302
  15. The extracellular domain of recombinant FGFRL1 promoted cell adhesion, but not cell spreading. Adhesion was mediated by heparan sulfate glycosaminoglycans located at the cell surface. PMID: 18061161
  16. mutant FGFRL1 contributes to the skeletal malformations of the patient PMID: 19056490

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed