Recombinant Human FGFRL1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-1494P
Recombinant Human FGFRL1 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-1494P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8N441 |
Synonym | FGF homologous factor receptor FGF receptor like protein 1 FGF receptor-like protein 1 FGFR 5 FGFR like protein FGFR-5 FGFR-like protein FGFR5 Fgfrl1 FGRL1_HUMAN FHFR Fibroblast growth factor receptor 5 Fibroblast growth factor receptor like 1 Fibroblast growth factor receptor-like 1 |
Description | Recombinant Human FGFRL1 Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGW SRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGK ESLGPDSSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVA SGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVS NRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDV KPVIQWLKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLL ITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDPKPPGPPVASSSSATS LPWP |
Molecular Weight | 66 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its bind this protein with a linear range of 0.16 - 2 μg/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Please see notes section. |
Target Details
Target Function | Has a negative effect on cell proliferation. |
Subcellular Location | Membrane; Single-pass type I membrane protein. Note=Predominantly localized in the plasma membrane but also detected in the Golgi and in secretory vesicles. |
Database References | |
Tissue Specificity | Expressed preferentially in cartilaginous tissues and pancreas. Highly expressed in the liver, kidney, heart, brain and skeletal muscle. Weakly expressed in the lung, small intestine and spleen. |
Gene Functions References
- this study shows FGFRL1 promotes ovarian cancer progression by crosstalk with Hedgehog signaling PMID: 29675438
- FGFRL1 is a transmembrane receptor that can induce the fusion of CHO cells to multinucleated syncytia. This cell fusion activity has been attributed to the extracellular Ig3 domain of the receptor. The Ig3 domain from humans, mice, chicken and fish stimulates fusion of CHO cells, while the Ig3 domain from lancelet and sea urchin does not. PMID: 28596102
- Both in vitro and in vivo studies determined that miR-210 promoted hepatocellular carcinoma (HCC), angiogenesis, and the corresponding mechanism was identified to be the direct targeting and inhibition of fibroblast growth factor receptor-like 1 (FGFRL1) expression PMID: 27666683
- FGFRL1 is a cell adhesion protein. PMID: 27220341
- functional evidence for a novel FGFRL1 poly-miRTS rs4647940 in a previously known 4p16.3 locus, and experimental and clinical genetics studies have shown both FGFRL1 and hsa-miR-140-5p are important for bone formation. PMID: 25941324
- Cell-cell fusion induced by the Ig3 domain of receptor FGFRL1 PMID: 26025674
- The signaling complex appears to integrate the input from FGFR and EphA4, and release the output signal through FRS2alpha. PMID: 20184660
- study identified a novel region of deletion mapping to 4p16.3 in 15 percent of bladder tumors and 24 percent of bladder cancer cell lines; FGFRL1, which maps within this region, was investigated as putative deletion target; average FGFRL1 protein expression was lower in bladder tumors compared to normal tissue, but downregulation was independent from 4p16.3 LOH status PMID: 23775577
- Interaction of FGFRL1 with Spred1 increases the proportion of the receptor at the plasma membrane. PMID: 21616146
- an important role for miR-210 as a tumor-suppressive microRNA with effects on cancer cell proliferation PMID: 21044961
- FGFRL1 is capable of inducing syncytium formation of heterologous cells in vitro. PMID: 20851884
- FGFRL1 is indeed a decoy receptor for FGFs. PMID: 19920134
- analysis of FGF18 and FGFR5(FGFRL1) expression in primary endothelial cells and vascular smooth muscle cells PMID: 16019430
- Screening of 241 different human tumors with the help of a cancer profiling array suggested major alterations in the relative expression of FGFRL1 in ovarian tumors PMID: 16273302
- The extracellular domain of recombinant FGFRL1 promoted cell adhesion, but not cell spreading. Adhesion was mediated by heparan sulfate glycosaminoglycans located at the cell surface. PMID: 18061161
- mutant FGFRL1 contributes to the skeletal malformations of the patient PMID: 19056490