Recombinant Human FGL1 Protein
Beta LifeScience
SKU/CAT #: BLA-1496P
Recombinant Human FGL1 Protein
Beta LifeScience
SKU/CAT #: BLA-1496P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | FGL 1 Fgl1 FGL1_HUMAN Fibrinogen like 1 Fibrinogen like protein 1 Fibrinogen related protein 1 Fibrinogen-like protein 1 Hepassocin Hepatocellular carcinoma related sequence Hepatocyte derived fibrinogen related protein 1 Hepatocyte-derived fibrinogen-related protein 1 HFREP 1 HFREP-1 HFREP1 HP 041 HP-041 HP041 LFIRE 1 LFIRE-1 LFIRE1 Liver fibrinogen related protein 1 Liver fibrinogen-related protein 1 MFIRE 1 MGC108569 MGC12455 MGC37822 OTTHUMP00000122468 |
Description | Recombinant Human FGL1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDE NTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGG GWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQE DYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGN FHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNG VYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI |
Molecular Weight | 58 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |