Recombinant Human FGL1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1498P
Recombinant Human FGL1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-1498P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q08830 |
Synonym | FGL 1 Fgl1 FGL1_HUMAN Fibrinogen like 1 Fibrinogen like protein 1 Fibrinogen related protein 1 Fibrinogen-like protein 1 Hepassocin Hepatocellular carcinoma related sequence Hepatocyte derived fibrinogen related protein 1 Hepatocyte-derived fibrinogen-related protein 1 HFREP 1 HFREP-1 HFREP1 HP 041 HP-041 HP041 LFIRE 1 LFIRE-1 LFIRE1 Liver fibrinogen related protein 1 Liver fibrinogen-related protein 1 MFIRE 1 MGC108569 MGC12455 MGC37822 OTTHUMP00000122468 |
Description | Recombinant Human FGL1 Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVI DLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTV IQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTL KIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPE VQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYS GPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI |
Molecular Weight | 36 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3. Responsible for LAG3 T-cell inhibitory function. Binds LAG3 independently from MHC class II (MHC-II). Secreted by, and promotes growth of, hepatocytes. |
Subcellular Location | Secreted. |
Database References | |
Tissue Specificity | Under normal conditions, liver-specific. |
Gene Functions References
- FGL1 promotes invasion and metastasis of gastric cancer and is associated with poor prognosis. PMID: 29845203
- findings highlight the crucial role of HFREP1 in insulin resistance and diabetes, and provide a potential strategy and biomarker for developing therapeutic approaches to combat these diseases. PMID: 27221093
- Hepassocin plays an important role in non-alcoholic fatty liver disease and induces hepatic lipid accumulation through an ERK1/2-dependent pathway. PMID: 23792031
- Here, the application of small ubiquitin-related modifier (SUMO) fusion technology in combination with four different chaperone teams on the soluble expression of recombinant HPS protein was explored and analyzed. PMID: 24084006
- Findings suggest that hepassocin promotes hepatic cell line L02 cells proliferation via an autocrine mechanism and inhibits HCC cells proliferation by an intracrine pathway. PMID: 21618590
- data demonstrated that liver-specific gene LFIRE-1/HFREP-1 was frequently downregulated and might possess growth suppressor activity in HCC PMID: 14981537
- HFREP-1 in plasma almost completely bound to the fibrin matrix during clot formation PMID: 16996032
- The enhancement of FGL1 levels in vitro by IL-6 and its induction after turpentine oil injection suggest that it is an acute phase reactant. PMID: 18039467
- HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC. PMID: 19304666