Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09206P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09206P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fibroblast Growth Factor 12 (FGF12) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P61328 |
Target Symbol | FGF12 |
Synonyms | EIEE47; FGF-12; Fgf12; FGF12_HUMAN; FGF12B; FHF-1; FHF1; Fibroblast growth factor 12; Fibroblast growth factor 12B; Fibroblast growth factor FGF 12b; Fibroblast growth factor homologous factor 1; Myocyte activating factor; Myocyte-activating factor |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
Expression Range | 1-181aa |
Protein Length | Full Length of Isoform 2 |
Mol. Weight | 47.4kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation. |
Subcellular Location | Nucleus. |
Protein Families | Heparin-binding growth factors family |
Database References | |
Associated Diseases | Epileptic encephalopathy, early infantile, 47 (EIEE47) |
Tissue Specificity | Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures. |
Gene Functions References
- FGF12 has a potential role in ESCC. PMID: 29049013
- In this study, the authors observed that rs1460922 of FGF12 was significantly associated with VT and identified that a de novo variation of FGF12 may be an important genetic risk factor for the pathogenesis of VT. PMID: 28775062
- FGF12, RBFOX1, and MIR302F could be important in human heterotaxy, because they were noted in multiple cases. Further investigation into genes involved in the NODAL, BMP, and WNT body patterning pathways and into the dosage effects of FGF12, RBFOX1, and MIR302F is warranted. PMID: 27637763
- FGF12 strongly induced the quiescent and contractile vascular smooth muscle cell phenotype and directly promoted VSMC lineage differentiation. PMID: 27470512
- Results demonstrate that gain-of-function FHF mutations can cause neurologic disorder, and expand the repertoire of genetic causes (FHF1) and mechanisms (altered Nav gating) underlying early-onset epileptic encephalopathies and cerebellar atrophy PMID: 27164707
- Nine SNPs of the FGF12 gene were associated with Kashin-Beck disease. PMID: 26290467
- Data indicate that SCN5A variant (Nav1.5) p.H1849R affected interaction with fibroblast growth factor homologous factor (FHFs). PMID: 26392562
- Q7R-FGF12 is a disease-associated BrS mutation. Moreover, these data suggest for the first time that FHF effects on Na(+) and Ca(2+) channels are separable. PMID: 24096171
- VAX1 rs10787760, rs6585429 and rs1871345 polymorphisms may be involved in nonsyndromic cleft lip with or without cleft palate in Brazilian patients, but there is no association with polymorphisms in FGF12, VCL, or CX43 PMID: 23679094
- PHOX2B, FGF12 and GAD2 genes are hypermethylated in colorectal neoplastic tissue PMID: 22552777
- exogenous FGF12 can play a role in tissues by translocating into cells through the plasma membrane PMID: 21518765
- Fibroblast growth factor homologous factor 1B (FHF1B) modulated the cardiac sodium channel Nav1.5. PMID: 12401812
- x-ray crystal structure of FHF1b PMID: 12815063
- Data describe the biophysical characterization and folding of fibroblast growth factor homologous factor-1b (FHF-1b) in comparison with acidic fibroblast growth factor (FGF-1), and show that FHF-1 is significantly more stable than FGF-1. PMID: 18289114
- These findings suggest that FGF12 intracellularly suppresses radiation-induced apoptosis in mast cells independently of IB2. PMID: 18525161