Recombinant Human Fibroblast Growth Factor 2 (FGF2), Active

Name: Recombinant Human Fibroblast Growth Factor 2 (FGF2), Active
Brand: Beta LifeScience
SKU: BLC-05954P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase, Recombinant fibroblast growth factor basic (fgfb/fgf2/bfgf) proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fibroblast Growth Factor 2 (FGF2), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Uniprotkb	P09038
Target Symbol	FGF2
Synonyms	Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Expression Range	132-288aa
Protein Length	Partial
Mol. Weight	17.4 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Subcellular Location	Secreted. Nucleus.
Protein Families	Heparin-binding growth factors family
Database References	HGNC: 3676 OMIM: 134920 KEGG: hsa:2247 STRING: 9606.ENSP00000264498 UniGene: PMID: 29989583 miR-155 and FGF2 is associated with esophageal cancer progression. miR-155 in Tumor-associated macrophages suppressed ECA109cell proliferation, migration and invasion, as well as reduction in angiogenesis. miR-155-reduced cell growth, migration and invasion of ECA109cells is associated with FGF2 suppression. PMID: 29660336 the dual warhead-FGF2 conjugate may overcome the potential acquired resistance of FGFR1-overproducing cancer cells towards single cytotoxic drugs. PMID: 30029518 widely stained in sclerosing stromal tumours of the ovary PMID: 29433373 FGF2 initiates CYGB transcription via the JNK pathway. PMID: 28916723 A strong stromal FGF-2 expression was associated with a significantly higher clinical stage and higher biochemical recurrence rate. Patients with strong stromal FGF-2 expression also had a significantly worse biochemical recurrence-free survival. PMID: 29887238 levels of the angiogenesis mediators endoglin, HB-EGF, BMP-9 and FGF-2 in patients with severe sepsis and septic shock PMID: 28746898 Our results suggest photodynamic therapy is effective in increasing the expression of bFGF gene, an important factor in periodontal tissue regeneration and could indicate periodontal tissue regeneration PMID: 28935533 High FGF2 expression is associated with gastric cancer. PMID: 28500362 Regulation of vascular smooth muscle cell calcification by syndecan-4/FGF-2/PKCalpha signalling and cross-talk with TGF-beta1. PMID: 29016732 evaluation of the presence and localization of FGF2 in human sperm cells, and determination of FGF2 levels in semen samples and its relationship with conventional semen parameters PMID: 28732140 We have presented evidence that FGF2 promotes myofibroblast apoptosis in vivo, antagonizes pro-fibrotic TGF-beta signaling, inhibits fibroblast activation and prevents transdifferentiation of non-fibroblasts into myofibroblasts, and promotes a less fibrotic gene expression paradigm [Review] PMID: 28967471 These results demonstrate that FGF-TGFbeta signaling antagonism is the primary regulator of the smooth muscle cell phenotype switch. PMID: 27634335 Results describe a novel role of FGF2 as a modulator of osteoblast and mesenchymal stromal cell function, and provide evidence for involvement of FGF2 in leukemia pathogenesis and chemo-resistance. PMID: 27481339 Under specific experimental conditions, secretion of IL-1beta and FGF2 is triggered by phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2]-dependent formation of pores across the plasma membrane. PMID: 28871048 HDAC1 depletion activates cardiac mesenchymal stromal cells proangiogenic paracrine signaling in a basic fibroblast growth factor-dependent manner. PMID: 28679560 The results suggest that FGF2/rs1048201, FGF5/rs3733336 and FGF9/rs546782 are associated with the risk of non-syndromic orofacial cleft and that these miRNA-FGF interactions may affect non-syndromic orofacial cleft development. PMID: 27511275 TEC is yet another regulator of FGF2-mediated Human pluripotent stem cells pluripotency and differentiation. PMID: 28631381 bFGF in primary tumor tissue associated with favorable breast cancer outcome and its levels significantly and positively correlated with ER levels. PMID: 28869446 Serum FGF-2 levels were statistically significantly lower in the autism spectrum patient group compared to healthy controls. PMID: 28734240 Dysregulation of the FGF2 gene represents an opportunity to understand further, and possibly intervene upon, mechanisms of wound healing in diabetics with CKD. PMID: 27237708 Out of five FGF-2 Gene Polymorphism loci, the TA genotype of rs308442 in the osteoporosis group (40.2%) was higher than in the control group (29.5%) (p < 0.05). The rs308442 locus of FGF-2 gene is closely correlated to osteoporosis in this Zhuang ethnic Chinese cohort, and the TA may be the risk genotype of osteoporosis. PMID: 28653999 Up-regulation of FGF2 and down-regulation FAM201A were correlated with the development of osteonecrosis of the femoral head after femoral neck fracture. PMID: 29382571 over-expression, isolation, and biological activity of all recombinant human FGF2 isoforms, are reported. PMID: 28433654 We found that hsa-miR-196a-3p affected expression on both mRNA and protein levels of FGF2. our study provided evidence that a functional SNP rs1048201 was associated with bone mineral density (BMD), and SNP rs1048201 variant may act by affecting binding of hsa-miR-196a-3p PMID: 28317323 Data show that mutant soluble ectodomain of FGFR2IIIc (msFGFR2c) but not wild-type soluble ectodomain of FGFR2IIIc (wsFGFR2c) could selectively bind to c subtype of FGFRs in the presence of FGF-2. PMID: 28049184 Furthermore, MERS coronavirus induced apoptosis through upregulation of Smad7 and fibroblast growth factor 2 (FGF2) expression in both kidney and lung cells. PMID: 27572168 The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors. PMID: 26096243 Studies indicate that therapeutically targeting FGF2 and FGFR has been extensively assessed in multiple preclinical studies and numerous drugs and treatment options have been tested in clinical trials. PMID: 27007053 FGF2 is involved in melanoma development and progression. HMW FGF2 isoforms enhance in vitro motility of melanoma cells. LMW FGF2 confers stem-like features and increases in vivo metastasization. LMW FGF2 promotes angiogenesis while HMW FGF2 induces vasculogenic mimicry. PMID: 27558498 miR-105/Runx2 axis mediates FGF2-induced ADAMTS expression in osteoarthritis cartilage. PMID: 26816250 results suggest that MALAT1-mediated FGF2 protein secretion from Tumor-associated macrophages inhibits inflammatory cytokines release, promotes proliferation, migration, and invasion of FTC133 cells and induces vasculature formation. PMID: 28543663 This study reveals that Adv ECM hydrogels recapitulate matrix fiber microarchitecture of native adventitia, and retain angiogenesis-related actors and bioactive properties such as FGF2 signaling capable of influencing processes important for angiogenesis. PMID: 28167392 Data show that FGF2 mutants have potential as anti-angiogenic agents and useful tools for studying the role of integrin alphavbeta3 in FGF2 signalling. PMID: 28302677 Expression of these mediators was confirmed in end-stage COPD. Thus, accumulation of mast cells in COPD may contribute to vascular remodeling. PMID: 28298222 Results provide evidence that bFGF regulates stemness maintenance in stem cells isolated from human exfoliated deciduous teeth (SHEDs) by enhancing REX-1 mRNA expression via the FGFR and Akt signaling pathways. Moreover, IL-6 is also involved in the bFGF-induced REX1 expression. PMID: 27883224 Facial nerve regeneration using basic fibroblast growth factor-impregnated gelatin microspheres PMID: 24737684 These results indicated that FGF-2, but not FGF-10, may be supplemented during stem cell expansion to prime cells for successful chondrogenesis and osteogenesis. PMID: 27411850 the data suggest that endothelial cells regulate beta-catenin activity in adrenocortical cells also via secretion of basic fibroblast growth factor. PMID: 27889473 In an in vitro assay of vascular smooth muscle cells, circRNA WDR77 silencing significantly inhibited cell proliferation and migration. Bioinformatics methods revealed that miR-124 and fibroblast growth factor 2 (FGF-2) were downstream targets of circRNA WDR77. PMID: 29042195 FGF2 protects the tumor cells from the antiproliferative effect of Gefitinib and largely prevents reprogramming of the proteome and phosphoproteome PMID: 27794612 High FGF2 expression is associated with colon cancer metastasis. PMID: 28629469 These observations identify airway smooth muscle cells -derived FGF2b as a factor needed for LMC formation by CD4 T cells, affecting intercellular communication. PMID: 28924004 Report no relationship between serum bFGF levels and ovarian cancer microvessel density and tumor bFGF expression. PMID: 27312585 High FGF2 expression is associated with ovarian cancer. PMID: 28481872 The antitumor activity of scopoletin may be due to its strong anti-angiogenic effect, which may be mediated by its effective inhibition of ERK1, VEGF-A, and FGF-2. PMID: 27133199 TGF-beta, bFGF and epimorphin in the extracellular microenvironment cooperatively affect HSF behaviors under the control of a highly sulfated chondroitin sulfate PMID: 28209294 High FGF2 expression is associated with lung cancer. PMID: 28423625 miR-205 enhances chemosensitivity of breast cancer cells to TAC docetaxol, doxorubicin plus cyclophosphamide) by suppressing both VEGFA and FGF2, leading to evasion of apoptosis. PMID: 27362808 analyses identified a new bFGF-regulating mechanism by which hedgehog signaling regulates human fibroblast migration; this data opens a new avenue for the wound healing therapy PMID: 28363830

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Fibroblast Growth Factor 2 (FGF2), Active

Recombinant Human Fibroblast Growth Factor 2 (FGF2), Active

Product Overview

Target Details

FAQs