Recombinant Human Fibroblast Growth Factor 4 (FGF4), Active

Name: Recombinant Human Fibroblast Growth Factor 4 (FGF4), Active
Brand: Beta LifeScience
SKU: BLC-05935P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Enzymes, Featured enzyme molecules, Growth factors and receptors, Kinase, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fibroblast Growth Factor 4 (FGF4), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Uniprotkb	P08620
Target Symbol	FGF4
Synonyms	FGF-4; Fgf4; FGF4_HUMAN; Fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; HBGF4; Heparin secretory-transforming protein 1; Heparin-binding growth factor 4; Hst; HST-1; HST1; HSTF-1; HSTF1; Human stomach cancer transforming factor from FGF related oncogene; K FGF; Kaposi Sarcoma Oncogene; KFGF; KS3; Oncogene HST; Transforming protein KS3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	Tag-Free
Complete Sequence	SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Expression Range	54-206aa
Protein Length	Partial
Mol. Weight	16.9 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Subcellular Location	Secreted.
Protein Families	Heparin-binding growth factors family
Database References	HGNC: 3682 OMIM: 164980 KEGG: hsa:2249 STRING: 9606.ENSP00000168712 UniGene: Hs.1755

Gene Functions References

our study demonstrated that FGFR4 rs2011077 and rs1966265 are associated with the progression of cervical normal tissues to precancerous lesions in Taiwanese women. Moreover, rs351855 (Gly388Arg) is the only FGFR4 genetic polymorphism that is associated with patient survival. PMID: 28378614
Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer. PMID: 26828265
Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity. PMID: 25329002
Data show that the interaction between Artd1 and Sox2 is crucial for the first steps of the reprogramming process and that early expression of Fgf4 is an essential component for the successful generation of iPSCs. PMID: 23939864
Myoblasts which overexpress FGF-4 exhibit significant changes in cell cycle and pro-angiogenic potential with only slight differences in the expression of the myogenic genes. PMID: 21673370
In vivo stimulation of BT-474 cell growth by progesterone is associated with up-regulation of FGF4 which may promote tumor growth and maintenance. PMID: 22237711
knockdown of FGFR4 expression led to decreased proliferation and an increased rate of apoptosis in the MKN45 and SGC7901 GC cell lines PMID: 21567388
activation of human HST-1 gene in transgenic mice induces spermatogenesis and prevents adriamycin-induced testicular toxicity PMID: 11840335
Differential effects of FGF4, EGF and TGFB1 on functional development of stromal layers (progenitor cell-outputs) in acute myeloid leukemia PMID: 12163055
FGF4 is upregulated by the OCT3 transcription factor in breast cancer cells. PMID: 12841847
HST-1 protects male germ cells from apoptosis under heat-stress condition in a mouse model. PMID: 14980503
Both myeov and hst (fgf4) are normally situated approximately 475-kb apart at band 11q13, a region that is frequently amplified and overexpressed in various tumours. PMID: 17390055
FGF-4 increases the rate at which MSC proliferate and has no significant effect on MSC pluripotency PMID: 17852409
These results suggest a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at later stages of development. PMID: 18192227
Implantation of human FGF4-soaked beads is sufficient to restore expression of G1- and S-phase cell-cycle genes and S-phase progression in zebrafish sonic hedgehog (Shh) mutant fin buds. PMID: 18811955
The combined action of retinoic acid and FGF4 results in induction of PDX1+ foregut endoderm. PMID: 19277121

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.