Recombinant Human Fibroleukin (FGL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09332P
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FGL2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FGL2.
Recombinant Human Fibroleukin (FGL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09332P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fibroleukin (FGL2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q14314 |
Target Symbol | FGL2 |
Synonyms | FGL2; FGL2_HUMAN; fibrinogen like 2; Fibrinogen like protein 2; Fibrinogen-like protein 2; Fibroleukin; pT49; T49 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
Expression Range | 24-439aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 51.6kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in physiologic lymphocyte functions at mucosal sites. |
Subcellular Location | Secreted. |
Database References | |
Tissue Specificity | Constitutively expressed in cytotoxic T-cells. |
Gene Functions References
- serum levels of soluble FAS ligand (sFASL) and interferon gamma (IFN-gamma) were analyzed and correlated with sFGL2 levels in Hepatitis C Virus-Infected Patients and Hepatocellular Carcinoma Patients. PMID: 28609212
- Data suggest that fibrinogen-like protein 2 (hFGL2) gene silencing via miRNA may be an alternative strategy for the management of hepatocellular carcinoma (HCC). PMID: 27163335
- Report increased expression of FGL-2 in peripheral blood mononuclear cells from mycosis fungoides patients. PMID: 27535237
- these results suggest that FGL-2 mediates angiogenesis and tumorigenesis not by thrombin-mediated mechanism but rather through FGF-2/ERK signaling pathway. PMID: 25496996
- Results show that FGL2 functions as a key immune-suppressive modulator and has potential as an immunotherapeutic target for treating glioblastoma multiforme (GBM). PMID: 25971300
- FGL-2 prothrombinase activity in PBMC of lymphoma patients is increased in active disease and normalizes during remission, thus being a potential marker for follow up of lymphoma patients. PMID: 25303152
- Studied fibrinogen-like protein 2 expression and its role in CRC metastasis and underlying molecular mechanisms; results suggest that FGL2 plays an important oncogenic role in CRC aggressiveness by inducing EMT. PMID: 25129313
- The selected peptide sequence NPG-12 may be a critical domain for hfgl2 prothrombinase activity. PMID: 24728278
- The proliferation index of CD8(+)T cells after blocking FGL2 was higher. PMID: 22886967
- immunomodulatory activity of FGL2 may be involved in the immunopathogenesis of inflammatory bowel disease PMID: 24287641
- Circulating fibrinogen-like protein 2 is increased in patients with systemic sclerosis. PMID: 22983266
- Serum fgl2 levels were increased among renal allograft recipients with acute rejection episodes to an extent dependent upon the pathological type and severity of the response. PMID: 23195010
- FGL2 contributes to hepatocellular carcinoma tumour growth and angiogenesis in a thrombin-dependent manner, and downregulation of its expression might be of therapeutic significance in HCC. PMID: 22925132
- HBV surface antigen-induced transcription of hfgl2 prothrombinase gene. PMID: 22082274
- FGL2 plays an important role in macrophage activation in the lungs of COPD patients through MAPK pathway modulation. PMID: 20438701
- FGL2 expression may be critical to the pathogenesis of renal allograft rejection; these data provide a rationale for targeting the fgl2 gene in an attempt to modulate allograft rejection. PMID: 15905589
- Results suggest that virus-induced fibrinogen-like protein 2 prothrombinase/fibroleukin expression and associated coagulation activity play a pivotal role in initiating severe hepatitis. PMID: 16437596
- fgl2 gene transcription induced by the N protein of SARS-CoV was dependent on transcription factor C/EBP alpha binding with its cognate cis-element in fgl2 promoter. PMID: 18390877
- Hepatitis B virus-induced hFGL2 transcription is dependent on c-Ets-2 and MAPK signal pathway PMID: 18801734
- Human fg12 contributes to the hypercoagulability in cancer and may induce tumor angiogenesis and metastasis via cytokine induction. PMID: 18932275
- SARS-CoV N protein specifically modulates transcription of the FGL2 gene to cause fibrosis and vascular thrombosis. PMID: 19423547