Recombinant Human Fibroleukin (FGL2) Protein (His)

Name: Recombinant Human Fibroleukin (FGL2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10444P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Fibroleukin (FGL2) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q14314
Target Symbol	FGL2
Synonyms	FGL2; FGL2_HUMAN; fibrinogen like 2; Fibrinogen like protein 2; Fibrinogen-like protein 2; Fibroleukin; pT49; T49
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Expression Range	24-439aa
Protein Length	Full Length of Mature Protein
Mol. Weight	49.6kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in physiologic lymphocyte functions at mucosal sites.
Subcellular Location	Secreted.
Database References	HGNC: 3696 OMIM: 605351 KEGG: hsa:10875 STRING: 9606.ENSP00000248598 UniGene: Hs.520989
Tissue Specificity	Constitutively expressed in cytotoxic T-cells.

Gene Functions References

serum levels of soluble FAS ligand (sFASL) and interferon gamma (IFN-gamma) were analyzed and correlated with sFGL2 levels in Hepatitis C Virus-Infected Patients and Hepatocellular Carcinoma Patients. PMID: 28609212
Data suggest that fibrinogen-like protein 2 (hFGL2) gene silencing via miRNA may be an alternative strategy for the management of hepatocellular carcinoma (HCC). PMID: 27163335
Report increased expression of FGL-2 in peripheral blood mononuclear cells from mycosis fungoides patients. PMID: 27535237
these results suggest that FGL-2 mediates angiogenesis and tumorigenesis not by thrombin-mediated mechanism but rather through FGF-2/ERK signaling pathway. PMID: 25496996
Results show that FGL2 functions as a key immune-suppressive modulator and has potential as an immunotherapeutic target for treating glioblastoma multiforme (GBM). PMID: 25971300
FGL-2 prothrombinase activity in PBMC of lymphoma patients is increased in active disease and normalizes during remission, thus being a potential marker for follow up of lymphoma patients. PMID: 25303152
Studied fibrinogen-like protein 2 expression and its role in CRC metastasis and underlying molecular mechanisms; results suggest that FGL2 plays an important oncogenic role in CRC aggressiveness by inducing EMT. PMID: 25129313
The selected peptide sequence NPG-12 may be a critical domain for hfgl2 prothrombinase activity. PMID: 24728278
The proliferation index of CD8(+)T cells after blocking FGL2 was higher. PMID: 22886967
immunomodulatory activity of FGL2 may be involved in the immunopathogenesis of inflammatory bowel disease PMID: 24287641
Circulating fibrinogen-like protein 2 is increased in patients with systemic sclerosis. PMID: 22983266
Serum fgl2 levels were increased among renal allograft recipients with acute rejection episodes to an extent dependent upon the pathological type and severity of the response. PMID: 23195010
FGL2 contributes to hepatocellular carcinoma tumour growth and angiogenesis in a thrombin-dependent manner, and downregulation of its expression might be of therapeutic significance in HCC. PMID: 22925132
HBV surface antigen-induced transcription of hfgl2 prothrombinase gene. PMID: 22082274
FGL2 plays an important role in macrophage activation in the lungs of COPD patients through MAPK pathway modulation. PMID: 20438701
FGL2 expression may be critical to the pathogenesis of renal allograft rejection; these data provide a rationale for targeting the fgl2 gene in an attempt to modulate allograft rejection. PMID: 15905589
Results suggest that virus-induced fibrinogen-like protein 2 prothrombinase/fibroleukin expression and associated coagulation activity play a pivotal role in initiating severe hepatitis. PMID: 16437596
fgl2 gene transcription induced by the N protein of SARS-CoV was dependent on transcription factor C/EBP alpha binding with its cognate cis-element in fgl2 promoter. PMID: 18390877
Hepatitis B virus-induced hFGL2 transcription is dependent on c-Ets-2 and MAPK signal pathway PMID: 18801734
Human fg12 contributes to the hypercoagulability in cancer and may induce tumor angiogenesis and metastasis via cytokine induction. PMID: 18932275
SARS-CoV N protein specifically modulates transcription of the FGL2 gene to cause fibrosis and vascular thrombosis. PMID: 19423547

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.