Recombinant Human Follistatin/FST Protein
Beta LifeScience
SKU/CAT #: BLA-0253P
Recombinant Human Follistatin/FST Protein
Beta LifeScience
SKU/CAT #: BLA-0253P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P19883 |
Synonym | Activin binding protein Activin-binding protein Follistatin FS fst FST_HUMAN Human follistatin gene |
Description | Recombinant Human Follistatin/FST Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKW MIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWK GPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSST CVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLG RSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSK SDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |
Molecular Weight | 32 kDa |
Purity | >95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Neutralization of human Activin A induced cytotoxicity of MPC-11 cells -‰¤200 ng/mL; -‰¥ 5.0 x 10E3 units/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at room temperature. Store at -20°C. |