Recombinant Human Galectin 10 Protein
Beta LifeScience
SKU/CAT #: BLA-1540P
Recombinant Human Galectin 10 Protein
Beta LifeScience
SKU/CAT #: BLA-1540P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | C5HZ13 |
Synonym | BSF3 Charcot Leyden crystal protein Charcot-Leyden crystal protein CLC EC 3.1.1.5 Eosinophil lysophospholipase Gal-10 Galectin-10 LGALS10 LGALS10A LPPL HUMAN LPPL_HUMAN Lysolecithin acylhydrolase MGC149659 |
Description | Recombinant Human Galectin 10 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACF LNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKN MPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDI SLTKFNVSYLKR |
Molecular Weight | 19 kDa including tags |
Purity | >90% SDS-PAGE.Purified using conventional chromatography techniques. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |