Recombinant Human Galectin 2 Protein

Name: Recombinant Human Galectin 2 Protein
Brand: Beta LifeScience
SKU: BLA-1542P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P05162
Synonym	Beta galactoside binding lectin L14 II Beta-galactoside-binding lectin L-14-II CBP35 Gal-2 GAL3 GALBP Galectin 2 Galectin-2 GALIG HL14 Lactose binding lectin 2 Lactose-binding lectin 2 LEG2_HUMAN LGALS2 MAC2 S Lac lectin 2 S-Lac lectin 2
Description	Recombinant Human Galectin 2 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MGSSHHHHHHSSGLVPRGSHMTGELEVKNMDMKPGSTLKITGSIADGTDG FVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGS EVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKL KE
Molecular Weight	17 kDa including tags
Purity	>95% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.

Target Details

Target Function	This protein binds beta-galactoside. Its physiological function is not yet known.
Database References	HGNC: 6562 OMIM: 150571 KEGG: hsa:3957 STRING: 9606.ENSP00000215886 UniGene: Hs.531776

Gene Functions References

Study observed decreased methylation at the DHCR24 locus in offspring of women with active pregnancy eating disorders (ED) and increased methylation at the LGALS2 locus in offspring of women with past ED compared to controls. PMID: 29093763
Data show that lactose binding to galectin-2 (Gal-2) stabilizes the lectin's conformation. PMID: 27563008
Gal-3 was significantly downregulated only in the extravillous trophoblast of intrauterine growth restriction ( IUGR) placentas. In contrast, expressions of gal-2 and gal-13 were downregulated in both villous and extravillous trophoblast cells of IUGR placentas. PMID: 27070577
Galectin-2 binding to different circulating human monocyte subsets depends on monocyte surface expression levels of CD14. It skews human macrophages to a M1-like proinflammatory phenotype. PMID: 25884209
PPARG rs1152002, AGTR1 rs5186, CXCL16 rs3744700 and LGALS2 rs7291467 polymorphisms may be closely related to the development of coronary heart disease PMID: 26045830
Lower LGALS2 gene expression is associated with acute myeloid leukemia. PMID: 25953264
Data suggest that expression of galectin 2 and galectin 2 mRNA is down-regulated in placental extravillous trophoblast and decidua in women with pre-eclampsia as compared to women with normal term pregnancy. PMID: 25707742
The increased circulation of galectins -2, -4 and -8 in cancer patients contributes substantially to the increased circulation of G-CSF, IL-6 and MCP-1 by interaction with the blood vascular endothelium PMID: 24384681
Cys57Met (single-site) mutant and its monoPEGylated derivative can markedly reduce binding of galectin-2 to physiological binding sites PMID: 23581621
results identify galectin-2 as a novel inhibitor of arteriogenesis and its modulation may constitute a new therapeutic strategy for the stimulation of arteriogenesis in patients with coronary artery disease. PMID: 21831908
LTA and LGALS2 polymorphisms affect the subclinical phenotype of the coronary artery, which predisposes to the incidence of myocardial infarction. PMID: 22310064
low expression of galectin-2 was significantly associated with lymph node metastasis and advanced clinical stage in patients with gastric cancer PMID: 22015694
These results suggested differences in the inflammatory response to malaria in children and adults with polymorphisms of the galectin-2 gene. PMID: 20500087
the LTA gene and LGALS2-C3279T are not associated with coronary artery disease PMID: 19726041
Our case-control association study in a Japanese population showed that a single nucleotide polymorphism in LGALS2 encoding galectin-2 is significantly associated with susceptibility to myocardial infarction PMID: 15129282
This study classifies galectin-2 as proapoptotic effector for activated T cells, raising a therapeutic perspective. PMID: 15356130
Fasting plasma glucose and serum insulin were statistically significantly associated with LGALS2 PMID: 16468038
Galectin 2 induces surface phosphatidylserine exposure in a carbohydrate-dependent fashion in activated, but not resting, human neutrophils and in several leukocyte cell lines. PMID: 16940423
no significant association of allele frequency with risk of myocardial infarction PMID: 17098239
polymorphism of LGALS2 was not associated with the severity of coronary atherosclerosis in Japanese and Korean populations PMID: 17493152
Data show that galectin-2 SNPs are not associated with myocardial infarction in two different German populations. PMID: 17497114
Galectin-2 was present in nuclei of Geneti-cally engineered human colon carcinoma cells with stable ectopic expression. PMID: 17999373
Data show that genotypes for the 3279C-->T polymorphism (rs7291467) of LGALS2 was associated (P<0.05) with the prevalence of atherothrombotic cerebral infarction. PMID: 18506375
Galectin-2 (LGALS2) 3279C/T polymorphism may be independently associated with diastolic blood pressure in patients with rheumatoid arthritis. PMID: 19330599
Galectin-2 is strongly expressed in inflammatory skin of autoimmune-prone transgenic mice, indicating that galectin-2 is up-regulated upon experimental cutaneous inflammation. PMID: 19380789

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.