Recombinant Human GDNF Receptor alpha 1/GFRA1 Protein
Beta LifeScience
SKU/CAT #: BLA-0284P
Recombinant Human GDNF Receptor alpha 1/GFRA1 Protein
Beta LifeScience
SKU/CAT #: BLA-0284P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P56159-2 |
Synonym | GDNF family receptor alpha 1 GDNF family receptor alpha-1 GDNF R GDNF RA GDNF receptor alpha GDNF receptor alpha-1 GDNFR GDNFR alpha GDNFR alpha 1 GDNFR-alpha-1 GDNFRA GDNFRalpha GFR alpha 1 GFR alpha1 GFR-alpha-1 GFRA 1 Gfra1 GFRA1_HUMAN GFRalpha1 Glial cell line derived neurotrophic factor receptor alpha GPI linked anchor protein MGC23045 PI linked cell surface accessory protein RET 1L RET ligand 1 RET1L RETL 1 RETL1 TGF beta related neurotrophic factor receptor 1 TGF-beta-related neurotrophic factor receptor 1 TRNR 1 TRNR1 |
Description | Recombinant Human GDNF Receptor alpha 1/GFRA1 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRS AMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPV NSRLSDIFRVVPFISVEHIPKGNNCLDAAKACNLDDICKKYRSAYITPCT TSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTERRRQTI VPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLK ENYADCLLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFL NFFKDNTCLKNAIQAFGNGSDVTVWQPAFPVQTTTATTTTALRVKNKPLG PAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNYEKEGLGASS HITTK |
Molecular Weight | 46 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its bind this protein with an apparent KD <10nM. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |