Recombinant Human Granulocyte Colony-Stimulating Factor Protein (CSF3) Protein (His)

Name: Recombinant Human Granulocyte Colony-Stimulating Factor Protein (CSF3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08403P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Colony-stimulating factors and receptors (csfs), Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Granulocyte Colony-Stimulating Factor Protein (CSF3) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P09919
Target Symbol	CSF3
Synonyms	C17orf33; Colony stimulating factor 3 (granulocyte); Colony stimulating factor 3; CSF 3; CSF beta; CSF3; CSF3_HUMAN; CSF3OS; Csfg; Filgrastim; G-CSF; GCSA; GCSF; Granulocyte colony stimulating factor; Granulocyte colony-stimulating factor; Lenograstim; Macrophage granulocyte inducer 2; MGC45931; MGI 2; Pluripoietin
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	VQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV
Expression Range	27-200aa
Protein Length	Partial
Mol. Weight	22.6kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Subcellular Location	Secreted.
Protein Families	IL-6 superfamily
Database References	HGNC: 2438 OMIM: 138970 KEGG: hsa:1440 STRING: 9606.ENSP00000225474 UniGene: Hs.2233

Gene Functions References

G-CSF and IL-6 concentrations may be predictive of the onset of neonatal Leukemoid reaction. PMID: 29459579
we described the construction and characterization of three G-CSF dimeric proteins generated using different linker peptides. GCSF-Lalpha had the best performance in terms of purity and in vitro activity PMID: 28721592
this study shows that cortisol inhibits CSF3 via DNA methylation and inhibits invasion in first-trimester trophoblast cells PMID: 28846166
We propose that in aggressive pancreatic ductal adenocarcinoma , elevated G-CSF contributes to tumor progression through promoting increases in infiltration of neutrophil-like cells with high immunosuppressive activity. Such a mechanism provides an avenue for a neoadjuvant therapeutic approach for this devastating disease PMID: 28775207
conclusion, there was an elevated lipolysis condition within the FF of Polycystic Ovary Syndrome (PCOS) with metabolic syndrome (MS) patients and the TNF-alpha and G-CSF levels in FF were associated with top-quality embryo percentage. PMID: 28082237
a set of IL-17A-regulated genes in keratinocytes, which recapitulate typical psoriasis genes exemplified by DEFB4A, S100A7, IL19 and CSF3, based on the differences in the expression profiles of cells stimulated with six cytokines versus cells stimulated with only five cytokines lacking IL-17A. PMID: 26944069
The results showed that the addition of recombinant IL-1 markedly increased G-CSF expression in fibroblasts; however, IL-1 receptor antagonist only partially abrogated KCM-stimulated G-CSF expression, indicating the role of additional keratinocyte-releasable factors PMID: 27340768
Data reviewed establish that any damage to brain tissue tends to cause an increase in G-CSF and/or GM-CSF (G(M)-CSF) synthesized by the brain. Glioblastoma cells themselves also synthesize G(M)-CSF. G(M)-CSF synthesized by brain due to damage by a growing tumor and by the tumor itself stimulates bone marrow to shift hematopoiesis toward granulocytic lineages away from lymphocytic lineages. PMID: 28459367
CD146/MCAM is the functional galectin-3-binding ligand on endothelial cell surfaces responsible for galectin-3-induced secretion of metastasis-promoting cytokines. PMID: 28364041
These results suggest that G-CSF could decrease the Th1/Th2 ratio in the context of immune thrombocytopenic purpura, and elucidate the direct and indirect immunomodulatory mechanisms underlying G-CSF functions in Th1/Th2 cells. PMID: 27815970
GCSF impairs CD8(+) T cell functionality by interfering with central activation elements. PMID: 26990855
High expression of G-CSF is associated with Tongue squamous cell carcinoma. PMID: 27316348
this study shows that haplotypes consisting of single nucleotide polymorphisms harboring PSMD3, CSF3 and MED24 genes are associated with asthma in Slovenian patients PMID: 27163155
Cancer cells can produce IL-18, which is involved in the process of angiogenesis, stimulates invasion and metastasis. Decrease in SIPA for the production of IL-6 and GCSF by peripheral blood cells could serve as an indicator of malignant progression in invasive ductal breast carcinoma. PMID: 27021370
G-CSF showed favorable effects only on the migration of HUVECs, and no direct influence was found on Osteoblasts. PMID: 27006951
tumor G-CSF expression is an indicator of an extremely poor prognosis in cervical cancer patients that are treated with chemotherapy. PMID: 26666576
G-CSF stimulates beta1 integrin expression and Swan 71 cell migration by activating PI3K and MAPK signaling pathways. PMID: 26992288
these data suggest that G-CSF may contribute to tumor growth and decrease the antitumor effect of radiotherapy, possibly by promoting vascularization in cancer lesions. PMID: 25976379
in vitro chemotaxis assays and an in vivo transplantation model for chemoattraction confirmed that UCX((R)) are chemotactic to CD34(-)/CD45(-) BM-MSCs via a cell-specific mobilization mechanism mediated by G-CSF. PMID: 24480602
Case Report: undifferentiated colon carcinoma producing G-CSF. PMID: 25400792
increases MMP-2 activity and VEGF secretion in trophoblasts through activation of PI3K/Akt and Erk signaling pathways PMID: 25249155
Elevated IL-8 and G-CSF may be involved in the pathophysiology of narcolepsy. PMID: 24994458
GM-CSF, through its stimulatory function on macrophages, may promote aneurysm progression. PMID: 25389911
G-CSF constrains cancer to grow and progress by, respectively, supporting the survival of sympathetic nerve fibers in 6-hydroxydopamine-sympathectomized mice. PMID: 24975135
Transgenic poultry with a gene of human granulocyte colony-stimulating factor (gcsf) was developed by arti- ficial insemination with the transfected sperm PMID: 25510103
Data suggest that long-term protein secondary structural stability/unfolding of GCSF can be modeled from short-term physicochemical phenomena assessed via spectroscopic measurements. PMID: 24421157
SCF+G-CSF treatment in chronic stroke remodels neural circuits in the aged brain PMID: 23750212
The results demonstrated that 3DHSA-G-CSF has the ability to increase the peripheral white blood cell (WBC) counts of neutropenia model mice, and the half-life of 3DHSA-G-CSF is longer than that of native G-CSF. PMID: 24151579
HNF1A gene was associated with C-reactive protein, and the region including PSMD3 and CSF3 genes was associated with white blood cell count. PMID: 22788528
Administration of G-CSF in a dosage regimen commonly used for bone marrow donors is well tolerated and safe, and provides a signal of positive change in a task of cognitive performance in 8 patients with mild to moderate stage Alzheimer's disease. PMID: 22751169
activation of the RAS/MEK/ERK pathway regulates G-CSF expression through the Ets transcription factor PMID: 23530240
These data suggest that GCSF, which is raised in patient serum, may play an important role in exacerbating disease in ANCA vasculitis. PMID: 23087180
CEACAM1 inhibits both G-CSF production by myeloid cells and G-CSF-stimulated tumor angiogenesis PMID: 23319418
G-CSF level in sera of patients with advanced stages of breast cancer was elevated compared to early stages. PMID: 23244154
G-CSF and VEGF levels in sera might be associated with an early phase of brain protection after birth in severe asphyxia treated with head cooling. PMID: 22944463
Granulocyte-colony stimulating factor contributes to glioma progression that may be linked to glioma genesis and recurrence. PMID: 22313638
Plasma G-CSF is elevated after injury and is greater in patients with shock. The rise in G-CSF is associated with prolonged mobilization of hematopoietic progenitor cells. PMID: 23063381
Treatment of 6-week-old bone marrow stromal cells with GCSF significantly improves their proliferation activity and growth factor production and recovers therapeutic effects in the injured brain. PMID: 21981141
Alteration of Dickkopf-1 and receptor activator of nuclear factor-kappaB ligand during PBSC mobilization in healthy donors by G-CSF. PMID: 22120987
These findings suggest that IL-1beta, IL-1Ra, and granulocyte colony-stimulating factor are functional markers of EV71-related cardiac dysfunction. PMID: 22829643
G-CSF administration at 10 mug/kg/day is safe for patients with worsening symptoms of compression myelopathy and may be effective for their neurological improvement. PMID: 21935680
Non-small cell lung cancer specimens with G-CSF expression exhibited poor differentiation, remarkable atypia, prominent necrosis and infiltration of tumor mass by neutrophils or emperipolesis. PMID: 22336152
Decreased soluble TGF-beta1, Tie-2, and angiopoietins serum levels in bone marrow after treating healthy donors with granulocyte colony-stimulating factor. PMID: 22465760
Elevated plasma GCSF concentration was positively correlated with the severity of ischemic stroke PMID: 22440005
Induction of Bv8 expression by granulocyte colony-stimulating factor in CD11b+Gr1+ cells: key role of Stat3 signaling. PMID: 22528488
G-CSF can ameliorate cardiac diastolic dysfunction and morphological damage, especially fibrosis of the myocardium, in Otsuka Long-Evans Tokushima fatty rats with diabetic cardiomyopathy. PMID: 21999467
Human recombinant G-CSF enhances angiogenesis following indirect bypass surgery, a combined therapy that is a safe and easy method of treatment. PMID: 21273924
Case Report: diagnosis of G-CSF-producing ascending colon cancer. PMID: 22443081
Prdx4 inhibits G-CSF-induced signalling and proliferation in myeloid progenitors. PMID: 22045733
Data indicate that serum G-CSF levels were lower in JAK2 V617F-positive vs. negative erythrocytosis. PMID: 21645282

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.