Recombinant Human Gremlin 1 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-4330P
Recombinant Human Gremlin 1 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-4330P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O60565 |
Synonym | BMP antagonist 1 Cell proliferation inducing gene 2 protein Cell proliferation-inducing gene 2 protein CKTSF1B1 colorectal adenoma and carcinoma 1 Cysteine knot superfamily 1 Cysteine knot superfamily 1, BMP antagonist 1 Cysteine knot superfamily BMP antagonist 1 DAN domain family member 2 DAND2 Down regulated in Mos-transformed cells protein Down-regulated in Mos-transformed cells protein DRM grem1 GREM1_HUMAN GREMLIN Gremlin 1 homolog, cysteine knot superfamily Gremlin 1 like protein Gremlin 1, cysteine knot superfamily, homolog Gremlin-1 Gremlin1 IHG-2 IHG2 Increased in high glucose 2 Increased in high glucose protein 2 PIG2 Proliferation inducing gene 2 proliferation inducing gene 2 protein |
Description | Recombinant Human Gremlin 1 Protein (Fc Tag Active) was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | KKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVL ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNS FYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVK QCRCISIDLDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | 44 kDa including tags |
Purity | >95% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human BMP-2, Tag Free (0.2 μg/well) can bind this protein with a linear range of 0.0008-0.08 μg/mL. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |