Recombinant Human Haptoglobin (HP)

Beta LifeScience SKU/CAT #: BLC-05023P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Haptoglobin (HP)

Beta LifeScience SKU/CAT #: BLC-05023P
Regular price $613.00 Sale price $349.00Save $264
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Haptoglobin (HP) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P00738
Target Symbol HP
Synonyms Binding peptide; BP; Haptoglobin alpha chain; Haptoglobin alpha(1S) beta; Haptoglobin alpha(2FS) beta; Haptoglobin beta chain; Haptoglobin, alpha polypeptide; Haptoglobin, beta polypeptide; HP; HP2 ALPHA2; HP2ALPHA2; HPA1S; HPT; HPT_HUMAN; MGC111141; Zonulin
Species Homo sapiens (Human)
Expression System E.coli
Tag Tag-Free
Target Protein Sequence VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Expression Range 19-406aa
Protein Length Full Length of Mature Protein
Mol. Weight 43.3 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.; The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
Subcellular Location Secreted.
Protein Families Peptidase S1 family
Database References
Associated Diseases Anhaptoglobinemia (AHP)
Tissue Specificity Expressed by the liver and secreted in plasma.

Gene Functions References

  1. findings suggest that rs5471 is a strong genetic determinant of HP levels in Ghanaians, and this seems to be characteristic of Africans PMID: 29772214
  2. We report on the identification of a novel 72 kd Hb reactive species which is cross-linked to HDL and demonstrate that vitamin E in HDL is decreased in Hp 2-2 diabetes mellitus individuals. PMID: 29888289
  3. zonulin appears not to be an inflammatory marker in CKD. It seems it also does not play a role in the disturbances of iron metabolism in CKD. Its physiological role remains to be elucidated. PMID: 29134616
  4. High serum Haptoglobin levels, but not Hp1-Hp2 polymorphism is associated with polycystic ovary syndrome. PMID: 28900795
  5. Hp 2-2 phenotype is an independent predictor of postoperative acute kidney injury and is associated with decreased short and long-term survival after cardiac surgery in patients with diabetes mellitus. PMID: 28982674
  6. Due to its fluctuation, a single measurement of zonulin level is not recommended for assessment of intestinal barrier integrity. PMID: 28883692
  7. Review/Meta-analysis: No association was found between the Hp gene variants and retinopathy in type 2 diabetics. PMID: 28758129
  8. This study investigates the involvement of Hp glycosylation in gastric cancer. It examined the site-specific glycosylation of serum Hp, revealing the feasibility of glycoproteomic profiling as a powerful platform for potential diagnostic markers with high sensitivity and high specificity for gastric cancer. PMID: 29285644
  9. Differentially expressed haptoglobin can serve as a potential biomarker for type 2 diabetic mellitus in the American Hispanic population. PMID: 28218436
  10. identified that apolipoprotein-A1 and haptoglobin had significant predictive values for the prediction of recovery at 12 weeks in DILI, enabling the construction of a new prognostic panel, the DILI-ActiTest, which needs to be independently validated PMID: 29287080
  11. HP genetic variation may have utility as a biomarker of insulin resistance and diabetes risk in Arab-Americans. PMID: 29039222
  12. Given the importance of Hp glycosylation, its unknown and unclear biological complexity and significances, Hp glycosylation has become a major target in cancer research. Development of sensitive and specific detection of Hp glycosylation including large-scale validation may be significant steps forward to its clinical application. PMID: 26873173
  13. Data suggest that serum haptoglobin may act as useful clinical serological biomarkers in progression and prognostic evaluation in non-small cell lung cancer (NSCLC). PMID: 27248178
  14. Although better control may reduce the incidence of coronary artery disease in Type 1 diabetes, a residual risk related to the haptoglobin 2 allele remains. PMID: 27028131
  15. Regardless of the haptoglobin genotype, haptoglobin is associated with prevention of endothelial cell apoptosis in diabetes. PMID: 28830235
  16. study discovered a splice donor founder mutation in HP (NM_001126102.1:c.190 + 1G > C); this mutation occurs on the HP1 allele of the common copy number variant in HP and leads to loss of function of HP1; it associates with lower levels of haptoglobin, higher levels of non-high density lipoprotein cholesterol and greater risk of coronary artery disease PMID: 28398513
  17. the minor allele (T) of rs8062041 appeared to be protective against African Trypanosomiasis; haptoglobin related protein (HPR) is adjacent to HP and is a component of the Trypanolytic factor; the HP and HPR locus is duplicated in some people; the rs8062041 variant may be associated with this duplication and it is possible that increased production of HPR is the cause of protection associated with rs806204 PMID: 29077717
  18. These results suggest that the hippocampus of Hp 1-1 genetic carriers may be more vulnerable to the insults of poor glycemic control. PMID: 28860127
  19. Our results show an association between increased early-pregnancy serum zonulin concentration and gestational diabetes, suggesting zonulin as a possible predictor for gestational diabetes. PMID: 28319108
  20. Pilot study shows an association of the haptoglobin 2-2 genotype with low-grade inflammation, haptoglobin concentration and carotid artery intima-media thickness in multi-ethnic population from Singapore. PMID: 27190085
  21. We conducted a replication study using a dataset outside of the Challenge, and found the association between TP53INP2 and ER-negative breast cancer was significant (p = 5.07x10-3). Expression of HP (16q22.2) showed a suggestive association with ER-negative breast cancer in the discovery phase (Z = 4.30, p = 1.70x10-5) although the association was not significant after Bonferroni adjustment. PMID: 28957356
  22. Studies suggest an association of serum haptoglobin N-glycan variation with gastric cancer and might be a promising marker for the cancer screening. PMID: 28052004
  23. These results were consistent with the data of the clinical specimens. miR-122a could be a positive factor of zonulin by targeting EGFR, which increased the intestinal epithelial permeability in vivo and in vitro. PMID: 28641303
  24. Hp2 allele is associated with premature ischemic cardiovascular deaths after first-ever ischemic stroke. PMID: 28487337
  25. Vitamin E may provide benefit in reducing cardiovascular disease in haptoglobin Hp2-2 genotype individuals with diabetes. PMID: 28451949
  26. High serum levels of HP at baseline are associated with inadequate response of 12 weeks methotrexate treatment in recent-onset rheumatoid arthritis patients. PMID: 24863583
  27. Celiac disease (CD) is associated with elevation of the circulating zonulin level, the value of which correlates with the density of enteroviruses in CD patients with severe atrophic changes in the small bowel mucosa, particularly in cases of concomitant type 1 diabetes. PMID: 27995404
  28. Results show that zonulin was significantly higher in obese children when compared to healthy children, indicating a potential role of zonulin in the etiopathogenesis of obesity and related disturbances. PMID: 28008865
  29. Our findings suggest that increased serum zonulin concentration, i.e., increased intestinal permeability, contributes to metabolic endotoxemia, systemic inflammation, and insulin resistance in overweight pregnant women PMID: 28285651
  30. The present study demonstrated that the mRNA and protein expression levels of haptoglobin were increased in patients with psoriasis. PMID: 27571879
  31. SCC-specific HP peptide HP216 may have a role in lung squamous cell carcinoma and could be a serum biomarker PMID: 26783151
  32. Altered glycosylation, expression of serum haptoglobin and alpha-1-antitrypsin in chronic hepatitis C, hepatitis C induced liver cirrhosis and hepatocellular carcinoma patients. PMID: 27034286
  33. In addition to predicting the incidence of cardio-renal complications, HP 2-2 also increases susceptibility for cardio-renal mortality in type 1 diabetes. PMID: 26684170
  34. Findings suggest that the antioxidative and anti-inflammatory capacity of the Hp 2 is inferior to that of the Hp 1 allele. PMID: 26114833
  35. The ratio of the fucosylated peaks to their corresponding nonfucosylated forms shows that the fucosylated glycans from haptoglobin are upregulated in the case of hepatocellular carcinoma samples versus cirrhosis samples. PMID: 26503433
  36. The bifucosylated tetra-anntenary glycan of haptoglobin was upregulated in hepatocellular carcinoma patients of all etiologies. PMID: 26448449
  37. Ovarian cancer cells express both Hp and its receptor CCR2 but only after exposure to ascitic fluid, inducing moderated cell migration; results suggest that Hp-induced changes in the cell morphology, actin cytoskeleton structure, and migration ability of tumor cells, is possibly "preparing" these cells for the potential induction of the metastatic phenotype. PMID: 26211665
  38. Haptoglobin phenotype is unlikely to be an important modifier of cystic fibrosis phenotype. PMID: 26370551
  39. Recurring exonic deletions in HP likely enhance human health by lowering cholesterol levels in the blood. PMID: 26901066
  40. these results demonstrate that sHP is associated with poor prognosis of colorectal cancer patients and that HP promotes colorectal cancer cell invasion. PMID: 26756179
  41. Haptoglobin 2-2 genotype was an independent predictor of cerebral salt wasting syndrome after subarachnoid hemorrhage. PMID: 26348010
  42. Endothelial dysfunction may be influenced by Hp2/2 genotype in patients with type 1 diabetes with independence of classical CV risk factors. PMID: 26122942
  43. This study suggests a possible role of haptoglobin phenotype on iron metabolism abnormalities that are observed in Parkinson disease. PMID: 26228081
  44. The present study described differentially expressed human haptoglobin as a lung cancer serum protein biomarker, which may serve as a diagnostic and therapeutic target. PMID: 26005016
  45. Hp 2 type is associated with elevated systolic pulmonary arterial pressure and low plasma nitrite levels in hemodialysis patients specifically in the diabetes mellitus state. PMID: 26171400
  46. Serum levels of haptoglobin are higher in pancreatic cancer patients. PMID: 25861849
  47. Patients with type 2 diabetes and poor glycaemic control carrying the Hp 1-1 genotype may be at increased risk of cognitive impairment, particularly in the attention/working memory domain. PMID: 25628235
  48. Structure of the human Hp-Hb and Trypanosoma brucei brucei HpHbR protein complex is described. PMID: 25410714
  49. Report increased numbers of highly fucosylated Haptoglobin alpha isoforms in ascitic fluids and the presence of fucosylated Haptoglobin in tumor tissues of ovarian cancer Mexican patients associated with advanced stages of the disease. PMID: 24576319
  50. Serum zonulin levels are significantly elevated in newly diagnosed Chinese Type 2 diabetes patients, indicating a potential role of zonulin in the pathophysiology of type 2 diabetes in Chinese. PMID: 25238913

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed