Recombinant Human HB-EGF/DTR Protein
Beta LifeScience
SKU/CAT #: BLA-1557P
Recombinant Human HB-EGF/DTR Protein
Beta LifeScience
SKU/CAT #: BLA-1557P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q99075 |
Synonym | Diphtheria toxin receptor diphtheria toxin receptor (heparin-binding EGF-like growth factor) diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor) DT R DT-R DTR DTS DTSF HB-EGF HBEGF HBEGF_HUMAN HEGFL Heparin binding EGF like growth factor Heparin binding epidermal growth factor Heparin binding epidermal growth factor like growth factor Heparin-binding EGF-like growth factor Proheparin binding EGF like growth factor |
Description | Recombinant Human HB-EGF/DTR Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRK YKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Molecular Weight | 23 kDa |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | 3T3 cell proliferation -‰¤1 ng/mL; -‰¥ 1.0 x 10^6 units/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. |
Subcellular Location | [Heparin-binding EGF-like growth factor]: Secreted, extracellular space. Note=Mature HB-EGF is released into the extracellular space and probably binds to a receptor.; [Proheparin-binding EGF-like growth factor]: Cell membrane; Single-pass type I membrane protein. |
Database References |
Gene Functions References
- levels of the angiogenesis mediators endoglin, HB-EGF, BMP-9 and FGF-2 in patients with severe sepsis and septic shock; endoglin and HB-EGF could be involved in the host response of sepsis; additional studies are warrant to investigate their role as biomarker or therapeutic targets in sepsis PMID: 28746898
- HB-EGF plays a pro-inflammatory role in the active skin and lung lesions of systemic sclerosis. PMID: 29044628
- HB-EGF expression in serum may be a potential therapeutic indicator for novel HB-EGF-targeted therapy in recurrent ovarian cancer. PMID: 29970572
- both HBEGF upregulation and apoptosis were rescued by exogenous MMP2 PMID: 28731464
- Results support the idea that excess heparin binding epidermal growth factor-like growth factor (HB-EGF) leads to a significant elevation of vascular endothelial growth factor (VEGF) and ventricular dilatation. These data suggest a potential pathophysiological mechanism that elevated HB-EGF can elicit VEGF induction and hydrocephalus. PMID: 27243144
- These results suggest that HBEGF is an important EGFR ligand in cervical cancer and that cervical cancer cells are the predominant source of HBEGF. Therefore, we propose an autocrine EGFR stimulation model in cervical carcinomas. PMID: 28498437
- macrophage-secreted MMP-9 released HB-EGF from macrophages, which increased MMP9 in OVCA433, resulting in a positive feedback loop to drive HB-EGF release and increase proliferation in co-culture. PMID: 27888810
- Genome-wide significant (GWS) associations in single-nucleotide polymorphism (SNP)-based tests (P < 5 x 10(-8)) were identified for SNPs in PFDN1/HBEGF, USP6NL/ECHDC3, and BZRAP1-AS1. PMID: 28183528
- HB-EGF is implicated in DNA double strand breaks repair as silencing of HB-EGF increased gammaH2AX foci half-life as well as USP9X expression, two features that could be linked to the observed effect on Mcl-1. PMID: 28970067
- Heparan sulfate proteoglycans and heparin derivatives further enhance HBEGF-induced differentiation by forming a complex with the epidermal growth factor receptor PMID: 28174207
- this study suggests that HBEGF promotes the formation of gliomas, is necessary for tumor maintenance and therefore may be a novel therapeutic target. PMID: 28368403
- Results show that HBEGF is highly expressed in primary ovarian tumors and increases as the disease progresses. PMID: 28668900
- Serous carcinomatous component championed by expression of HB-EGF predisposes to recurrence/metastasis in stage I metastasis and recurrence in stage I uterine malignant mixed mullerian tumor. PMID: 26980026
- Annexin A2 and HB-EGF are overexpressed and are being secreted into serum in Her-2 negative breast cancer patients. PMID: 27496793
- Study demonstrates that HBEGF is post-transcriptionally regulated by low O2 (placental environment) through a mechanism involving interactions of miRNAs with its 3'UTR. PMID: 27701455
- MMP14 plays an important mechanistic role in NSCLC progression, by supporting cancer invasiveness, promoting collagen degradation, and releasing HB-EGF, which accelerates lung tumor progression. PMID: 28013056
- These results indicate that this new anti-HB-EGF mAb 2-108 would be useful in the diagnosis of HB-EGF-related cancers and would be a strong tool in both basic and clinical research on HB-EGF. PMID: 26974561
- This antibody reacts with human HB-EGF but not mouse HB-EGF. No cross-reactivity to other EGFR ligands was observed by antigen ELISA. PMID: 27097072
- HB-EGF is a molecular target for the resistance of ovarian cancer to paclitaxel and CRM197 as a HB-EGF-targeted agent might be a chemosensitizing agent for paclitaxel-resistant ovarian carcinoma PMID: 26572150
- Data suggest that placental expression of HBEGF, EGF (epidermal GF), and TGFA (transforming GF alpha) is down-regulated in pre-eclampsia as compared to normal term birth; each growth factor blocks cell death/apoptosis of cytotrophoblast cell line. PMID: 25589361
- Serum sHB-EGF is closely correlated with advanced stage gastric cancer and can be a promising serological biomarker for GC. PMID: 25717241
- Studies indicate that heparin-binding EGF-like growth factor (HB-EGF) is a therapeutic target in some types of cancers. PMID: 25517307
- the relative expression of hyalurosome (CD44, HAS3, HB-EGF) genes was found to be reduced in patients prior to topical treatment and to be notably increased following treatment. PMID: 25138066
- Urinary levels of NGF and HB-EGF may be potential biomarkers for evaluating outcome of overactive bladder syndrome treatment. PMID: 25510766
- HB-EGF is a biomarker for LPA1 receptor activation in human breast and prostate cancers. PMID: 24828490
- MiR-212 exerts suppressive effect on SKOV3 ovarian cancer cells through targeting HBEGF. PMID: 25201063
- Suggest high levels of HB-EGF contribute to carotid plaque stabilization and reduce the incidence of acute coronary events. PMID: 25359857
- Autocrine HBEGF expression promotes breast cancer intravasation, metastasis and macrophage-independent invasion in vivo. PMID: 24013225
- studies suggest disintegrin and metalloproteinase domain-containing protein 12(ADAM 12S) and heparin-binding epidermal growth factor-like growth factor(HB-EGF) are involved in cellular plasticity resulting in production of brown adipose tissue-like cells PMID: 24116709
- Knockdown of HSP27 by shRNA decreased HB-EGF plus CXCL5-mediated tumor spheroid formation in a three-dimensional culture system, suggesting that AKT/HSP27 was required for HB-EGF/CXCL5-mediated cancer progression PMID: 24346967
- Heparin-binding epidermal growth factor and CD9 are likely implicated in processes that are highly relevant for MS lesion formation PMID: 24038577
- HB-EGF acts as a potent paracrine and/or autocrine chemotactic factor as well as a mitogen that mediates HER1 and/or HER4 in the invasion and metastasis of thyroid carcinoma cells. PMID: 23917679
- Results suggest that HB-EGF plays a pivotal role in the acquisition of tumor aggressiveness in TNBC by orchestrating a molecular hierarchy regulating tumor angiogenesis. PMID: 23443317
- HB-EGF overexpression and Kras(G12D) together, but neither alone, increase cancer cell proliferation. PMID: 23376846
- Correlation has been found between HB-EGF expression/immunostaining and the different types of analyzed soft tissue sarcomas. PMID: 23597914
- The study suggest that one of the causes of unexplained miscarriages may result from the impaired expression of heparanase and heparin-binding EGF-like growth factor. PMID: 23907942
- A reciprocal cross-talk between intrahepatic cholangiocarcinoma cells and myofibroblasts through the HB-EGF/EGFR axis contributes to CCA progression. PMID: 23787814
- a mechanism of a probiotic-derived soluble protein in modulating intestinal epithelial cell homeostasis through ADAM17-mediated HB-EGF release, leading to transactivation of EGFR. PMID: 24043629
- visualized spatiotemporal regulation of proHB-EGF shedding in individual cells using a simple method that measures changes in fluorescence ratios PMID: 23598347
- results indicate that Abl kinases negatively regulate HNSCC invasive processes through suppression of an HB-EGF autocrine loop responsible for activating a EGFR-Src-cortactin cascade PMID: 23146907
- Our results show that HB-EGF acts as a cell proliferation and cell survival factor in cancer cells. PMID: 23349913
- Hypoxia increased the levels and activity of the ADAM12 metalloprotease in a Notch signaling-dependent manner, leading to increased ectodomain shedding of the epidermal growth factor (EGF) receptor (EGFR) ligand heparin-binding EGF-like growth factor. PMID: 23589494
- HB-EGF-C nuclear translocation might be crucial in gastric cancer invasion. HB-EGF-C nuclear translocation may offer a prognostic marker and a new molecular target for gastric cancer therapy. PMID: 22646534
- expression of HB-EGF in human KCs triggers a migratory and invasive phenotype with many features of epithelial-mesenchymal transition (EMT), which may be beneficial in the context of cutaneous wound healing. PMID: 22592159
- Results suggest that heparin-binding epidermal growth factor (EGF)-like growth factor (HB-EGF) is a target for oral cancer and that CRM197 is effective in oral cancer therapy. PMID: 22718294
- variant 1936T prevents hsa-miR-1207-5p from down-regulating HBEGF in podocytes PMID: 22319602
- study is the first report demonstrating a role for the ADAM-HBEGF-EGF receptor axis in Ox-PAPC induction of IL-8 in HAECs. PMID: 22402363
- These results confirm that polymorphisms in the HGEGF gene are associated with pre-eclampsia. PMID: 22136955
- Heparin-binding epidermal growth factor-like growth factor is a potent autocrine regulator of invasion activity in oral squamous cell carcinoma. PMID: 22209887
- Lung cancer-derived galectin-1 enhances tumorigenic potentiation of tumor-associated dendritic cells by expressing heparin-binding EGF-like growth factor. PMID: 22291012