Recombinant Human HDGFL1 Protein
Beta LifeScience
SKU/CAT #: BLA-1562P
Recombinant Human HDGFL1 Protein
Beta LifeScience
SKU/CAT #: BLA-1562P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | dJ309H15.1 HDGF (hepatoma-derived growth factor) like HDGFL1 HDGL1_HUMAN Hepatoma-derived growth factor-like protein 1 PWWP domain-containing protein 1 PWWP1 |
Description | Recombinant Human HDGFL1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSAYGMPMYKSGDLVFAKLKGYAHWPARIEHMTQPNRYQVFFFGTHETAF LSPKRLFPYKECKEKFGKPNKRRGFSAGLWEIENNPTVQASDCPLASEKG SGDGPWPEPEAAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAG DPPEDAPKRPKEAAPDQEEEAEAERAAEAERAAAAAAATAVDEESPFLVA VENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHAEAPGGGDRDS L |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |