Recombinant Human HGFA Inhibitor 2 Protein
Beta LifeScience
SKU/CAT #: BLA-1615P
Recombinant Human HGFA Inhibitor 2 Protein
Beta LifeScience
SKU/CAT #: BLA-1615P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O43291 |
Synonym | AL024025 Bikunin, placental C76321 DIAR3 FLJ45571 HAI-2 HAI2 Hepatocyte growth factor activator inhibitor type 2 Kop Kunitz type protease inhibitor 2 Kunitz-type protease inhibitor 2 Kunitz-type serine protease inhibitor MGC72638 PB Placental bikunin Serine peptidase inhibitor Kunitz type 2 Serine protease inhibitor, Kunitz type, 2 SPINT2 SPIT2_HUMAN |
Description | Recombinant Human HGFA Inhibitor 2 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNN YLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMF NYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEE ACMLRCFRQQENPPLPLGSKVDHHHHHH |
Molecular Weight | 20 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Please see notes section. |