Recombinant Human IDH1 (mutated R132 H) Protein
Beta LifeScience
SKU/CAT #: BLA-4792P
Recombinant Human IDH1 (mutated R132 H) Protein
Beta LifeScience
SKU/CAT #: BLA-4792P
Collections: Enzymes, Other enzymes, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | O75874 |
Synonym | Cytosolic NADP isocitrate dehydrogenase Cytosolic NADP-isocitrate dehydrogenase Epididymis luminal protein 216 Epididymis secretory protein Li 26 HEL-216 HEL-S-26 ICDH IDCD IDH IDH1 IDHC_HUMAN IDP IDPC Isocitrate dehydrogenase (NADP(+)) 1 cytosolic Isocitrate dehydrogenase [NADP] cytoplasmic Isocitrate dehydrogenase 1 (NADP+) soluble NADP dependent isocitrate dehydrogenase cytosolic NADP dependent isocitrate dehydrogenase peroxisomal NADP(+)-specific ICDH Oxalosuccinate decarboxylase PICD |
Description | Recombinant Human IDH1 (mutated R132 H) Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRD ATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR NILGGTVFREAIICKNIPRLVSGWVKPIIIGHHAYGDQYRATDFVVPGPG KVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA LSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRL IDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK LGENLKIKLAQAKLDYKDDDDK |
Molecular Weight | 48 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity: 53 pmol/min/μg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |