Recombinant Human Ephrin Type-A Receptor 3 (EPHA3) Protein (His), Active

Name: Recombinant Human Ephrin Type-A Receptor 3 (EPHA3) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05585P
Price: 349.0 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC 50 of the protein is 0.9734-1.179 ng/ml. Biological Activity Assay

Activity Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay. Biological Activity Assay

The purity of Human EPHA3 was greater than 95% as determined by SEC-HPLC

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Enzymes, Featured enzyme molecules, Kinase, Recombinant proteins, Recombinant proteins fall special offers - active proteins, Recombinant proteins holiday sale

Price Save $58

Size

100ug

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ephrin Type-A Receptor 3 (EPHA3) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE and HPLC.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC50 of the protein is 0.9734-1.179 ng/ml. 2. Human EPHA3 protein his tag captured on COOH chip can bind Human EFNA5 protein Fc tag with an affinity constant of 13.8 nM as detected by LSPR Assay.
Uniprotkb	P29320
Target Symbol	EPHA3
Synonyms	AW492086; Cek4; EC 2.7.10.1; EK4; End3; Eph receptor A3; EPH-like kinase 4; EPH-like tyrosine kinase 1; EPHA3; EPHA3_HUMAN; Ephrin receptor EphA3; Ephrin type-A receptor 3; ETK 1; ETK; ETK1; HEK 4; HEK; HEK4; Human embryo kinase 1; Human embryo kinase; Mek4; MGC109882; Receptor tyrosine kinase HEK; Testicular tissue protein Li 64; Tyro 4; Tyro4; TYRO4 protein tyrosine kinase; Tyrosine protein kinase receptor ETK 1; Tyrosine-protein kinase receptor ETK1; Tyrosine-protein kinase TYRO4
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Target Protein Sequence	ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ
Expression Range	21-541aa
Protein Length	Partial
Mol. Weight	61.0 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families	Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Database References	HGNC: 3387 OMIM: 114500 KEGG: hsa:2042 STRING: 9606.ENSP00000337451 UniGene: Hs.123642
Associated Diseases	Colorectal cancer (CRC)
Tissue Specificity	Widely expressed. Highest level in placenta.

Gene Functions References

High EPHA3 expression is associated with tumor growth and angiogenesis in gastric cancer. PMID: 30066881
To investigate the relationship between five EPHA3 single nucleotide polymorphisms (SNPs) and Nonsyndromic Cleft Lip With or Without Cleft Palate (NSCL/P), EPHA3 SNPs (rs7650466, rs1398197, rs17801309, rs1054750, and rs7632427) were genotyped. The rs7650466 T allele was associated with the incidence of NSCL/P as well as with protective and dominant effects in both conditions. PMID: 29932736
Although EPHA3 was reported to be one of the most frequently mutated genes in colorectal tumors, our studies using inducible isogenic cell line systems, mouse models and large human tumor collections, did not reveal a major role of this EPH receptor on proliferation/motility/invasion of cancer cells, tumor initiation/progression/metastasis in mouse models or survival of colorectal cancer patients. PMID: 28169277
The interaction of AR and SP1 contributes to regulate EPHA3 expression. PMID: 29917167
Findings suggest that EPH receptor A3 (EphA3) plays an important role in the pathogenesis of multiple myeloma (MM). PMID: 28721629
Study shows that EphA3 is highly overexpressed in multiple myeloma (MM) and provides evidence that EphA3 plays an important role in MM angiogenesis. PMID: 28415715
Results indicate that EphA3 protein expression is reduced in clear-cell renal cell carcinoma, suggesting the possibility that this receptor functions as a tumor suppressor in this disease. PMID: 27591824
EphA3 promotes malignant transformation of colorectal epithelial cells by upregulating oncogenic signaling pathways. PMID: 27721017
Data indicate that EPHA3 is involved in regulating the multidrug resistance (MDR) of small cell lung cancer (SCLC) via PI3K/BMX/STAT3 signaling and may be a therapeutic target in SCLC. PMID: 27101199
PTP-PEST regulates EphA3 activation both by affecting cytoskeletal remodelling and through its direct action as a PTP controlling EphA3 phosphorylation. PMID: 26644181
This study showed that EPHA3 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID: 26381449
A novel association between the EPHA3 deletion and prostate cancer risk was observed in Finnish individuals. PMID: 26552734
EphA3 forms dimers in the absence of ligand binding. PMID: 26232493
Data indicate that hypoxia increased EphA3 receptor (EphA3) mRNA expression in EphA3+ endometrial multipotent mesenchymal stromal cells (eMSCs). PMID: 25420155
EphA3 was induced by PC-1 and contributed to the malignant progression of prostate cancer PMID: 25231727
Based on the knowledge that EPHA4 has been previously shown to rescue SOD1 transgenic mice from ALS phenotype and prolongs survival, EPHA3 may be a promising candidate for therepuetic interventions PMID: 23991104
EphA3 may represent a novel candidate marker for patient prognosis as well a molecular target for HCC therapy. PMID: 23970317
EPHA3 mutations may promote tumorigenesis only when key senescence-inducing pathways have been inactivated. PMID: 23324396
EphA3 may play important roles in the angiogenesis and prognosis of gastric carcinoma PMID: 22350700
High EphA3 expression is associated with glioblastoma multiforme. PMID: 23410976
Cancer-associated EPHA3 mutations attenuate the tumor-suppressive effects of normal EPHA3 in lung cancer. PMID: 22829656
EphA3 has ephrin- and kinase-dependent tumor suppressing activities, which are disrupted by somatic cancer mutations PMID: 22242939
expression of EphA3 and CD133 in carcinoma was significantly higher than that in normal mucosal tissue PMID: 21415057
Experiments in EphA3/Isl2 knock-in mice test the interactions between effects of molecular labels and correlated activity during the development of neural connectivity. PMID: 21190559
Authors found significant association between the copy number variations of EphA3 and hematologic malignancies. PMID: 21454190
Data shew that the identification of three novel candidates as EPH receptor genes might indicate a link between perturbed compartmentalization of early neoplastic lesions and breast cancer risk and progression. PMID: 21124932
Data provide further support that ALS2CL, EPHA3, and CMYA1 are bona-fide tumor-suppressor genes and contribute to the tumorigenesis of HNSCC. PMID: 20657180
EphA3, was identified as a new CD28-responsive gene in Jurkat cells by using a human cytokine/receptor array. EphA3 expression in CD28-stimulated Jurkat cells was enhanced by IGF-1 or by overexpression of the IGF-1R. PMID: 14697337
Results show EPHA3 gene was implicated in the pathogenesis of lung cancer and it may be useful targets for diagnostic and therapeutic intervention in selected patients. PMID: 16941478
High-resolution structures of the EphA3 kinase with and without the juxtamembrane segment allowed mapping of the coupled pathway of residues that connect the juxtamembrane segment, the activation loop, and the catalytic residues of the kinase domain. PMID: 18547520
EphA3 expression may define subsets of rhabdomyosarcoma tumours, and that EphA3 suppresses motility through regulation of Rho GTPases in rhabdomyosarcoma cells. PMID: 18814179
D219V missense mutation in EPHA3 is associated with hepatocellular carcinoma. PMID: 19469653
mechanism of substrate binding PMID: 19678838

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.