Recombinant Human IGFBP3 Protein

Name: Recombinant Human IGFBP3 Protein
Brand: Beta LifeScience
SKU: BLA-1592P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P17936
Synonym	Acid stable subunit of the 140 K IGF complex Binding protein 29 Binding protein 53 BP 53 BP53 Growth hormone dependent binding protein IBP 3 IBP-3 IBP3 IBP3_HUMAN IGF binding protein 3 IGF-binding protein 3 IGFBP 3 IGFBP-3 IGFBP3 Insulin Like Growth Factor Binding Protein 3 Insulin-like growth factor binding protein 3 precursor Insulin-like growth factor-binding protein 3
Description	Recombinant Human IGFBP3 Protein was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSE GQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYL LPAPPAPGNASESEEDRSAGEVESPSVSSTHRVSDPKFHPLHSKIIIIKK GHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFL NVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTT KGKEDVHCYSMQSK
Molecular Weight	29 kDa
Purity	>95% SDS-PAGE.Greater than 98% by SDS-PAGE and HPLC analyses.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	The ED50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7. The expected ED50 for this effect is -‰¤ 0.2 µg/ml in presence of 15 ng/ml of human IGF-II.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle.

Target Details

Target Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. Inhibits the positive effect of humanin on insulin sensitivity. Promotes testicular germ cell apoptosis.
Subcellular Location	Secreted.
Database References	HGNC: 5472 OMIM: 146732 KEGG: hsa:3486 STRING: 9606.ENSP00000370473 UniGene: Hs.450230
Tissue Specificity	Expressed by most tissues. Present in plasma.

Gene Functions References

In cancerous tissues of colorectal cancer (CRC) patients, the miR197 level was inversely correlated with the expression of IGFBP3, which indicated that miR197 may modulate cell migration and invasion by targeting IGFBP3 in CRC patients. PMID: 30106114
Together findings presented here recognize an inherent role of MTA1 as a modifier of DNMT3a and IGFBP3 expression, and consequently, the role of MTA1-DNMT3a-IGFBP3 axis in breast cancer progression. PMID: 28393842
B-Myb is an independent prognostic marker and serves as a potential target in the diagnosis and/or treatment of NSCLC, and that B-Myb functions as a tumor-promoting gene by targeting IGFBP3 in NSCLC cells. PMID: 29772705
IGFBP-3 up-regulates PI3K/Akt/mTOR signaling pathway and down-regulates autophagy during cell aging. The decrease of IGFBP-3 expression in senescence and cell aging by H2O2 leads to up-regulation of mTOR and p53 signaling pathway, suggesting that IGFBP-3 could play a key role as an aging marker PMID: 29579543
Low IGFBP-3 serum levels were associated with Pancreatic Cancer. PMID: 28681154
IGFBP-3 Interacts with the Vitamin D Receptor in Insulin Signaling Associated with Obesity in Visceral Adipose Tissue PMID: 29112142
IGFBP3, a gene associated with preeclampsia pathophysiology, was validated as a target gene of miR-210 PMID: 28653360
analysis of IGFBP3-IGF1 correlation with the risk of esophageal carcinoma; the free form of IGFBP3, might be inversely associated with esophageal cancer incidence PMID: 28596684
Our data indicate that targeting IGFBP-3-dependent signaling pathways through gefitinib-FTY720 co-therapy may be effective in many basal-like breast cancers, and suggest tissue IGFBP-3 and CD44 measurement as potential biomarkers of treatment efficacy. PMID: 28778177
Laboratory models corroborate intertumor heterogeneity of endocrine response in HGSOC but identify features associated with functional ERalpha and endocrine responsiveness. Assessing ERalpha function (e.g., IGFBP3 expression) in conjunction with H-score may help select patients who would benefit from endocrine therapy. Preclinical data suggest that SERDs might be more effective than tamoxifen PMID: 28073843
In longitudinal analysis, changes of FGF-21 were not significantly related to changes of height, IGF-1 or IGFBP-3 in obese children. PMID: 26887040
the concentrations of insulin, IGF-1, IGFBP-3 and their association with prostate size in patients with BPH PMID: 28300542
We confirmed a previously reported association between circulating IGFBP-3 and diabetes risk in the older adult population PMID: 29040592
The results of this study, while not clearly supporting associations between these obesity-related biomarkers and renal cell carcinoma risk, are consistent with previously reported findings for adiponectin, and suggest an association with elevated IGFBP-3 among obese individuals PMID: 28484923
our results reveal a new function of IGFBP2, providing a novel insight into the mechanism of adipogenic differentiation and identifying a potential target mediator for improving adipose tissue engineering based on Wharton's jelly of the umbilical cord (WJCMSCs). PMID: 28859160
Increased IGFBP3 level as associated with decreased risk of frailty in men. PMID: 28609827
Functional IGFBP-3 was significantly lower in postmenopausal women than in premenopausal women, for both patients with rheumatoid arthritis and controls. There was a significant decrease in plasma functional IGFBP-3 levels in postmenopausal RA in comparison to healthy premenopausal subjects. PMID: 27775453
study suggests high-order interactions of the IGFBP-3 rs2854744 AA genotype, BMI>/=24kg/m2, and DISI<9.85 mg/day on increased BC risk, particularly among postmenopausal women PMID: 27631779
The stratification of individuals by gender revealed that Slovak males carrying IGFBP-3 G alleles (G32G or GG) had marginally increased risk for developing MDD as compared to CC homozygous males (p=0.09). In women, inverse association was observed between SNP rs1042522 and MDD risk (p=0.04 for recessive model). PMID: 27755861
results indicate that hypoxia suppresses the osteogenic differentiation of mesenchymal stem cells via IGFBP3 up-regulation. PMID: 27563882
Meta-analysis suggests that for esophageal cancer, the low IGFBP-3 level is associated with high cancer risk, poor prognosis, and unfavorable tumor stage and metastasis. [meta-analysis] PMID: 27978831
Expression of IL-24 and IGFBP-3 significantly suppressed prostate cancer tumor growth in vivo. PMID: 26323436
Blood IGFBP3 was lower in Black participants compared to Whites. PMID: 27455178
The microRNA-125b level promotes invasive ability in p53-mutated cells via PI3K/AKT activation by targeting of insulin-like growth factor-binding protein-3. PMID: 28378642
High expression of IGFBP3 is associated with metastasis in nasopharyngeal carcinoma. PMID: 27658775
results indicated that miR-197 targeted IGFBP3 to induce the overgrowth and anti-apoptotic effects of Wilms tumor cells PMID: 27223680
There is no interaction between IGFBP3 and MTA1 in ESCC, and they are not independent risk factors for esophageal squamous cell carcinoma prognosis. PMID: 27035126
Insulin-like growth factor binding protein-3 is a new predictor of radiosensitivity on esophageal squamous cell carcinoma PMID: 26670461
Study showed that IGFBP3 is dramatically induced in pancreatic tumors, and is abundantly produced in pancreatic cancer cells, causing muscle wasting through both impaired myogenesis via, at least, inhibition of IGF/PI3K/AKT signaling. PMID: 26975989
Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells via integrin beta1 signaling. PMID: 26540630
endogenous IGFBP-3 is a p53 target that plays a role in breast cancer cell responsiveness to DNA damaging therapy PMID: 26378048
Data indicate that IGF-binding protein 3 (IGFBP3) and F3 gene expression levels in formalin fixed paraffin embedded (FFPE) prostate cancer tissue would provide an improved survival prediction for prostate cancer patients. PMID: 26731648
calcineurin in astrocytes was activated by Amyloid beta, leading to IGFBP-3 release. PMID: 26637371
Circulating levels of IGF-1, IGFBP-3 and their molar ratio were not associated with the risk of occurrence of colorectal adenoma PMID: 26388613
Independent of obesity, high insulin levels but reduced levels of IGFBP-3 were associated with increased lung cancer risk in current smokers. PMID: 27071409
IGFBP-3 levels after ischemic stroke may independently predict functional outcome after one year. PMID: 26069074
-202 A/C IGFBP3 polymorphisms did not show any consistent association with clinical and laboratory features of acromegalic patients even after treatment. PMID: 25552351
polymorphism in IGFBP-3 rs2854744 A>C might be a potential predictor of esophageal squamous cell carcinoma risk and patient survival PMID: 26349977
Humanin Peptide Binds to Insulin-Like Growth Factor-Binding Protein 3 (IGFBP3) and Regulates Its Interaction with Importin-beta. PMID: 26216267
Authors demonstrate that IGFBP3 is a direct TAp73alpha (the p73 isoform that contains the trans-activation domain) target gene and activates the expression of IGFBP3 in actively proliferating cells. PMID: 26063735
Methylation of IGFBP-3 in colorectal cancer was identified to be significantly associated with risk of recurrence. PMID: 25822686
Data indicate that IGF binding protein-3 (IGFBP-3) reduced transcription of a variety of integrins, especially integrin beta4. PMID: 25945837
Serum IGFBP3 was increased in hepatocellular carcinoma patients compared to patients with liver cirrhosis, but lower than in healthy controls. PMID: 26068014
The current meta-analysis suggests that the IGFBP-3 C2133G polymorphism may confer susceptibility to colorectal cancer. [Meta-analysis] PMID: 25966104
In women with normal somatotroph function, IGFBP3 levels do not change in the first trimester of pregnancy. PMID: 25179796
Loss of IGFBP3 expression is associated with Colorectal Cancer. PMID: 25987030
IGFBP-3 polymorphism is not a cause of delayed infancy-childhood transition in idiopathic short stature children. PMID: 25742716
The functional IGFBP3 A-202C polymorphism may influence the susceptibility and progression of breast cancer in the Chinese population. PMID: 25960224
Results suggest that immediately postexercise testosterone and IGFPB-3 responses are significantly increased after endurance training followed by strength training but not after strength training followed by endurance training. PMID: 25028991
These findings indicate that IGFBP-3 enhances etoposide-induced cell growth inhibition by blocking the NF-kappaB signaling pathway in gastric cancer cells. PMID: 25662950

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.