Recombinant Human Ihh Protein

Beta LifeScience SKU/CAT #: BLA-0785P

Recombinant Human Ihh Protein

Beta LifeScience SKU/CAT #: BLA-0785P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q14623
Synonym BDA1 HHG-2 HHG2 IHH IHH_HUMAN Indian Hedgehog Indian hedgehog homolog Indian hedgehog protein Indian hedgehog protein C-product Indian hedgehog protein N-product
Description Recombinant Human Ihh Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSE RFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVK LRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFD WVYYESKAHVHCSVKSEHSAAAKTGG
Molecular Weight 20 kDa
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Intercellular signal essential for a variety of patterning events during development. Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones. Induces the expression of parathyroid hormone-related protein (PTHRP).
Subcellular Location [Indian hedgehog protein N-product]: Cell membrane; Lipid-anchor; Extracellular side.; [Indian hedgehog protein C-product]: Secreted, extracellular space.; Cell membrane.
Protein Families Hedgehog family
Database References
Associated Diseases Brachydactyly A1 (BDA1); Acrocapitofemoral dysplasia (ACFD)
Tissue Specificity Expressed in embryonic lung, and in adult kidney and liver.

Gene Functions References

  1. TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
  2. Association of pathogenic variants in IHH with short stature with nonspecific skeletal abnormalities and a frequent cause of growth disorder, with a preliminary good response to rhGH. PMID: 29155992
  3. Studies suggest significance of other signaling aside from hedgehog in the pathogenesis of basal cell carcinoma (BCC) of the skin. PMID: 28574612
  4. Gorlin syndrome-derived induced pluripotent stem cells (iPSCs) expressed lower basal levels than control iPSCs of the genes encoding the Hh ligands Indian Hedgehog (IHH) and Sonic Hedgehog (SHH). PMID: 29088246
  5. Hedgehog pathway activation in T-cell acute lymphoblastic leukemia predicts response to SMO and GLI1 inhibitors. PMID: 27694322
  6. CLIC4 and Ihh could serve as biological markers for the progression, metastasis and/or invasiveness of pancreatic ductal adenocarcinoma. PMID: 28205343
  7. The serum levels of IHH and SHH were significantly higher in autistic subjects than those of control subjects. The findings support a correlation between SHH, IHH and BDNF in autistic children, suggesting their pathological role in autism. PMID: 26691363
  8. Our results show for the first time that Indian hedgehog does not cause extracellular matrix degradation in healthy ex vivo cartilage or in the presence of IL-1beta PMID: 26705100
  9. The Annexin a2 Promotes Development in Arthritis through Neovascularization by Amplification Hedgehog Pathway. PMID: 26963384
  10. Studies indicate that the hedgehog (Hh) signaling pathway has become one of the most studied potential therapeutic targets in hematological malignancies. PMID: 24991722
  11. Findings demonstrated that Ihh promotes human cartilage endplate degeneration. PMID: 25958162
  12. endogenously produced IHH is playing a critical role in regulating hBMSC chondrogenesis. PMID: 25519748
  13. Duplication of the upstream IHH regulatory region and a correlation between the phenotype and the implicated regulatory regions in a family with craniosynostosis Philadelphia type. PMID: 25692887
  14. Data show that the Hh (Hedgehog) signalling pathway mediates chemoresistance of BCSCs (breast cancer stem cells) and contributes to the outcome in breast cancer patients. PMID: 26201092
  15. Data suggest that hedgehog (HH) signaling through transcription factors GLI1 and GLI2 could be required for the maintenance of pregnancy. PMID: 25888497
  16. Studies indicate that activation of the hedgehog (Hh) signaling pathway has been observed in several cancer types, including ovarian cancer. PMID: 23303278
  17. Gene transfer of indian hedgehog protein results in chondrogenic induction of mesenchymal stem cells. PMID: 22817660
  18. Data indicate that neutralizing hedgehog antibody MEDI-5304 represents a potent dual hedgehog inhibitor suitable for patients with tumors harboring elevated levels of sonic hedgehog (SHH) or indian hedgehog (IHH). PMID: 24344235
  19. Indian Hedgehog, a critical modulator in osteoarthritis, could be a potential therapeutic target for attenuating cartilage degeneration disease. PMID: 24844414
  20. Increased Ihh is associated with the severity of osteoarthritis cartilage damage. Elevated Ihh content in human knee joint synovial fluid correlates with early cartilage lesions. PMID: 24786088
  21. Data indicate that overexpression of Indian hedgehog (Ihh) signaling promotes abnormal chondrocyte differentiation in enchondral ossification and enhances bone formation in cervical ossification of the posterior longitudinal ligament (OPLL). PMID: 23883825
  22. We further indicated that SHH and IHH were highly expressed in metastatic tumors PMID: 23468532
  23. Studies indicate that upregulation of Hedgehog protein has been found in tumor-associated stroma and associated with vascularization and excessive stromal expansion can limit intratumoral drug delivery. PMID: 23575478
  24. Hedgehog signaling regulates hypoxia induced epithelial to mesenchymal transition and invasion in pancreatic cancer cells via a ligand-independent manner. PMID: 23786654
  25. Data indicate that compounds 7 and 9 (diterpene) showed cytotoxicity against cancer cell lines in which hedgehog (Hh) signaling was aberrantly activated. PMID: 23403897
  26. Data indicate that analysis of public microarray data suggests that PBOV1 activation in tumors could be dependent on the Hedgehog signaling pathway. PMID: 23418531
  27. Results suggest that hypoxia-induced increase of Smo directly contributes to the proliferation of pancreatic ductal adenocarcinoma (PDAC) cells through a hedgehog/Gli1-independent pathway. PMID: 22486854
  28. Intra-articular injection of human mesenchymal stem cells (MSCs) promote rat meniscal regeneration by being activated to express Indian hedgehog that enhances expression of type II collagen. PMID: 22750747
  29. A missense mutation in IHH gene is observed in an individual affected by brachydactyly type A1. PMID: 22406540
  30. A large duplication involving the IHH locus mimics acrocallosal syndrome PMID: 22234151
  31. Activation of Indian hedgehog promotes chondrocyte hypertrophy and upregulation of MMP-13 in human osteoarthritic cartilage. PMID: 22469853
  32. Ihh-induced Nkx3.2 degradation requires Wnt5a, which is capable of triggering Nkx3.2 degradation PMID: 22507129
  33. Studies indicate that pathways of Hedgehog (Hh), Wnt and Notch, which regulate development during embryonic life and somatic stem cells (SCs) in the adult organism, can be reactivated in malignancies and support tumor-initiating cells (TIC) scompartment. PMID: 22123293
  34. Studies indicate that IHH is required for normal chondrocyte proliferation during both embryonic and postnatal growth. PMID: 21642379
  35. Nuclear and cytoplasmic endometrial expression of Indian hedgehog is decreased in women with endometriosis. PMID: 21640343
  36. VLDL carries Ihh throughout the body in mammals PMID: 20839884
  37. the observed duplications lead to a misexpression and/or overexpression of IHH and by this affect the complex regulatory signaling network during digit and skull development. PMID: 21167467
  38. This data confirms genetic heterogeneity in Brachydactyly A1 (BDA1) and demonstrates that mutations upstream of IHH can result in BDA1. PMID: 20683927
  39. The temporal increase in endometrial IHH during the secretory phase, and their modulation by CDB-2914 suggests progestin role in endometrial differentiation and implantation. PMID: 20881264
  40. down-regulation of indian hedgehog expression as a result of hypermethylation, may be an early event in colorectal carcinogenesis PMID: 20854074
  41. Methylation analysis revealed that IHH promoter was hypermethylated in colon cancer cell lines. PMID: 19856079
  42. Indian hedgehog protein was detected in cystic tubules within human dysplastic kidneys; these molecules modify severity of this congenital malformation. Hedgehog signaling may be important stimulus for renal cyst formation. PMID: 20007344
  43. describes cloning of human IHH PMID: 7720571
  44. Data show that all of the BDA1 mutations occur in a restricted area of the N-terminal active fragment of the IHH. PMID: 19277064
  45. expression is preserved in the growth plate of human fetuses affected with fibroblast growth factor receptor type 3 activating mutations PMID: 12368206
  46. novel mutation causes brachydactyly type A1 PMID: 12384778
  47. A novel missense mutation in the IHH gene mapping to chromosome 5 has been identified identified in all patients of a brachydactyly type A1 family. PMID: 12525541
  48. Homozygous mutations in this gene cause acrocapitofemoral dysplasia, an autosomal recessive disorder with cone-shaped epiphyses in hands and hips. PMID: 12632327
  49. model of the interactions between beta-catenin and hedgehog signaling in the epidermis in which SHH promotes proliferation of progenitors of the hair lineages whereas IHH stimulates proliferation of sebocyte precursors PMID: 12917489
  50. a wide range of digestive tract tumours, including most of those originating in the oesophagus, stomach, biliary tract and pancreas, but not in the colon, display increased Hh pathway activity, which is suppressible by cyclopamine, a Hh pathway antagonist PMID: 14520411

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed