Recombinant Human Immunoglobulin Heavy Constant Gamma 1 (IGHG1), Active
Beta LifeScience
SKU/CAT #: BLC-05875P

Greater than 95% as determined by SDS-PAGE.
Recombinant Human Immunoglobulin Heavy Constant Gamma 1 (IGHG1), Active
Beta LifeScience
SKU/CAT #: BLC-05875P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Immunoglobulin Heavy Constant Gamma 1 (IGHG1), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml. |
Uniprotkb | P01857 |
Target Symbol | IGHG1 |
Synonyms | IGHG1; Immunoglobulin heavy constant gamma 1; Ig gamma-1 chain C region; Ig gamma-1 chain C region EU; Ig gamma-1 chain C region KOL; Ig gamma-1 chain C region NIE |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | Tag-Free |
Complete Sequence | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Expression Range | 104-330aa |
Protein Length | Partial |
Mol. Weight | 25.9 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen. |
Subcellular Location | Secreted. Cell membrane. |
Database References | |
Associated Diseases | Multiple myeloma (MM) |