Recombinant Human Insulin degrading enzyme / IDE Protein
Beta LifeScience
SKU/CAT #: BLA-1621P
Recombinant Human Insulin degrading enzyme / IDE Protein
Beta LifeScience
SKU/CAT #: BLA-1621P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P14735 |
Synonym | Abeta-degrading protease FLJ35968 Ide IDE_HUMAN Insulin protease Insulin-degrading enzyme Insulinase Insulysin OTTHUMP00000020097 |
Description | Recombinant Human Insulin degrading enzyme / IDE Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | RDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVV GEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |