Recombinant Human Interferon alpha10 Protein
Beta LifeScience
SKU/CAT #: BLA-0762P
Recombinant Human Interferon alpha10 Protein
Beta LifeScience
SKU/CAT #: BLA-0762P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | IFN-alpha-10 IFN10_HUMAN IFNA10 Interferon alpha 6L Interferon alpha C Interferon alpha-10 Interferon alpha-6L Interferon alpha-C interferon, alpha 10 LeIF C MGC119878 MGC119879 |
Description | Recombinant Human Interferon alpha10 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPF SCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW EQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRI TLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |