Recombinant Human Interferon beta Protein
Beta LifeScience
SKU/CAT #: BLA-0764P
Recombinant Human Interferon beta Protein
Beta LifeScience
SKU/CAT #: BLA-0764P
Collections: Cytokines and growth factors, Other cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | beta-interferon Fibroblast interferon IFB IFF IFN beta IFN-beta IFNB IFNB 1 IFNB_HUMAN IFNB1 Interferon beta Interferon beta 1 fibroblast Interferon beta precursor MGC96956 |
Description | Recombinant Human Interferon beta Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLE YCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGW NETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRI LHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |