Recombinant Human Interferon Beta Protein (IFNB1) Protein (GST)

Name: Recombinant Human Interferon Beta Protein (IFNB1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03969P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Interferons and receptors (ifn), Recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interferon Beta Protein (IFNB1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01574
Target Symbol	IFNB1
Synonyms	beta-interferon; Fibroblast interferon; IFB ; IFF; IFN beta; IFN-beta; IFNB 1; IFNB; IFNB_HUMAN; IFNB1; Interferon beta 1 fibroblast ; Interferon beta; Interferon beta precursor ; MGC96956
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Expression Range	22-187aa
Protein Length	Full Length of Mature Protein
Mol. Weight	47.0kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has antiviral, antibacterial and anticancer activities.
Subcellular Location	Secreted.
Protein Families	Alpha/beta interferon family
Database References	HGNC: 5434 OMIM: 147640 KEGG: hsa:3456 STRING: 9606.ENSP00000369581 UniGene: Hs.93177

Gene Functions References

Data indicate a mechanism used by monocyte chemotactic protein-inducing protein 1 (MCPIP1) to negatively regulated type I IFN interferon-beta antiviral defense. PMID: 29920243
It has been shown that HCMV has evolved mutational robustness against IFN-beta by limiting the presence of APOBEC3G hot spots in essential open reading frames of its genome. PMID: 30045985
RIG-I-like receptors have a role in induction of interferon-beta1 in antiviral gene expression PMID: 29098213
Transcriptomic analysis of early untreated dermatomyositis muscles revealed that the main cluster of down-regulated genes was mitochondria-related. Histochemical, electron microscopy, and in situ oxygraphy analysis showed mitochondrial abnormalities, including increased reactive oxygen species (ROS) production and decreased respiration, which was correlated with low exercise capacities and a type I IFN signature. PMID: 28623559
Gas6 bound to the fiber proteins of adenovirus and suppressed IFN beta production. PMID: 29288958
The overexpression of NPIPB3 restored the interferon-beta responses in severe acute respiratory syndrome coronavirus open reading frame 6 (SARS-CoV ORF6) expressing cells, indicating that the interaction of SARS CoV ORF6 and NPIPB3 reduced Type I interferon antagonism by SARS-CoV ORF6. PMID: 26320399
The results demonstrate that cystatin B interferes with the STAT-1 signaling and IFN-beta-antiviral responses perpetuating HIV in macrophage reservoirs. PMID: 27137788
This review briefly discusses the dysregulation of main T cell subpopulations in CNS autoimmunity and summarized the T cell targeted effects of endogenous and exogenous IFN-beta in health and EAE/MS, with emphasis on the direct actions of IFN-beta on each T cell subset involved in the disease. PMID: 27033173
c-Cbl negatively regulates IFN-beta signaling and cellular antiviral response by promoting IRF3 ubiquitination and degradation. PMID: 27503123
YPEL5 silencing enhanced the induction of IFNB1 by pattern recognition receptors and phosphorylation of TBK1/IKBKE kinases, whereas co-immunoprecipitation experiments revealed that YPEL5 interacted physically with IKBKE. PMID: 27705791
The effect of topical TREX1 knockdown and local interferon production on HIV transmission in human cervicovaginal explants and humanized mice, is reported. PMID: 27184854
The current knowledge on IFNbeta from its structure, dynamic conformation, signaling pathway, and mechanism of action to its therapeutic effects is summarized. PMID: 27572132
this study shows that the IFN-beta/STAT1 pathway is dysregulated in inflammatory bowel disease PMID: 27220814
results suggest that, in addition to its well-known signaling activity, IFN-beta may be directly antimicrobial and be part of a growing family of cytokines and chemokines, called kinocidins, that also have antimicrobial properties. PMID: 28411186
This study demonstrates a novel pathway for elevated IFNbeta signaling in SLE that is not dependent on stimulation by immune complexes but rather is cell intrinsic and critically mediated by IFNbeta and MAVS. PMID: 28471483
G45R mutation of NS1 slightly decreased NS1 binding to dsRNA but did not interfere with its suppression of RIG-I-mediated type I IFN production. PMID: 27405392
Upon influenza virus infection, DPF2 dysregulated IFN-beta induction and expression of cytokines/chemokines and antiviral proteins. This study provides evidence that influenza virus utilizes DPF2 to escape host innate immunity. PMID: 28404846
Overexpression of PKV VP3 blocked IFN-beta-induced activation of the STAT1/STAT2/IRF9 promoter in a dose-dependent manner. PMID: 28441586
Data suggest that EV71 infection in enterocytes does not inhibit phosphorylation of STAT1/2 induced by IFN-beta, but p-STAT1/2 transport into the nucleus is significantly blocked; EV71 infection in enterocytes down-regulates expression of KPNA1 and induces degradation of cellular KPNA1 via caspase-3. [EV17 = Enterovirus 71] PMID: 28455446
This study reveals that decreased induction of both PKR and p300 proteins contribute to impaired induction of IFN-beta in Chronic obstructive pulmonary disease primary bronchial epithelial cells upon influenza infection. PMID: 26807508
Together, these results suggest that RSV infection of MSCs alters their immune regulatory function by upregulating IFN-b and IDO, affecting immune cell proliferation, which may account for the lack of protective RSV immunity and for chronicity of RSV-associated lung diseases such as asthma and COPD. PMID: 27695127
ArfGAP domain-containing protein 2 (ADAP2) is identified as a key novel scaffolding protein that integrates different modules of the RIG-I pathway, located at distinct subcellular locations, and mediates cellular antiviral type I interferon production. PMID: 27956705
TBK1 complexes required for the phosphorylation of IRF3 and the production of interferon-beta have been identified. PMID: 28159912
RNAs isolated from HCV-replicating cells triggered robust IFN-beta and IFN-lambda production through MDA5. PMID: 27655134
These results suggest that inhibition of RIG-I-mediated type I interferon responses by Enterovirus 71 may contribute to the pathogenesis of viral infection. PMID: 27633794
the interactions of IRF1, IFN-beta and IRF5 are involved in the M1 polarization of macrophages and have antitumor functions. PMID: 27176664
The results demonstrate that PASylation has a positive impact on stability, solubility, and functional activity of IFN-beta1b and potentially might improve pharmacokinetic properties of the molecule as a therapeutic agent. PMID: 27833991
Data suggest that interferon beta (IFN-beta) might be involved in modulating the expressions of interferon regulatory factor 1 (IRF1) and interferon regulatory factor-5 protein (IRF5) as well as maintaining the M1 polarization status and its function. PMID: 27363262
Results suggest that serum levels of IFN-beta do not correlate well with the severity of dengue illness, but there is a clear association between changes in IFN-beta levels and the days of evolution during the acute phase of the disease. PMID: 26252251
Overexpression of KLF4 inhibited virus-induced activation of ISRE and IFN-b promoter in cells, while knockdown of KLF4 potentiated viral infection-triggered induction of IFNB1 and downstream genes and attenuated viral replication. PMID: 25531393
These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6. PMID: 26456228
the suppression of type I IFN production by HTLV-1 Tax through interaction with and inhibition of TBK1 kinase that phosphorylates IRF3 PMID: 26819312
IFN-b could be an effective agent not only through its cell growth inhibitory effect on GSCs but also as a means of targeting the interconversion between GSCs and non-GSCs. PMID: 26397698
These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1. PMID: 26437794
The Hantaan virus A9 N protein can influence the host innate immune response by regulating the activation of IFNbeta. PMID: 26196448
Together, the data demonstrate that interferon-beta inhibits foamy virus early in infection and that MxB is not a restriction factor of foamy virus. PMID: 26609934
The C-terminal region of Toscana Virus NSs protein is critical for interferon-beta antagonism and protein stability. PMID: 26474372
These findings support a model in which a measles virus defective interfering RNA is sensed by PACT and RIG-I to initiate an innate antiviral response via activation of interferon-beta production. PMID: 26608320
Data suggest microRNA-302c regulates interferon-beta production in innate/mucosal immunity partly via down-regulation of interferon regulatory factors IRF3/7; studies were conducted in lung epithelial cells infected with influenza A virus H3N2. PMID: 26602079
Data show that the MAPKKK6 ASK2, a modulator of MAPKKK5 ASK1 signaling, was essential for ASK1-dependent apoptosis, but not for inducing interferon-beta (IFNB) expression. PMID: 26243192
Data suggest ADAP2 (an interferon-beta stimulated gene) disrupts pathogenic internalization of some RNA viruses/virions (dengue, vesicular stomatitis) by altering ADP ribosylation factor 6-mediated processes including up-regulation of pinocytosis. PMID: 26372645
Data suggest that naturally occurring iDVGs (immunostimulatory defective viral genomes) trigger robust host antiviral/innate immunity responses including/requiring up-regulation of IFNB1 and IFNL1 (interferon lambda 1) in respiratory mucosa. PMID: 26336095
Data identify an IFNbeta1-dependent, cell-autonomous mechanism that contributes to the therapeutic resistance of melanoma via the PKCepsilon-ATF2 regulatory axis. PMID: 25728676
Early IFN-beta induction regulated virus replication in glioblastoma cells, whereas delayed IFN-beta induction resulted in efficient virus replication in neuroblastoma cells. PMID: 25920530
Virion-associated R6 the type I IFN response by preventing efficient binding of IRF3/CBP complexes to the IFN-beta promoter in the context of infection. PMID: 25972548
new IFN-beta response genes were identified in B cells, with possible implications to B cell-specific functions PMID: 25025430
Reduced myelin basic protein-induced CD4+ T-cell autoreactivity in interferon-beta-treated multiple sclerosis patients may be mediated by monocyte-derived interleukin-10 PMID: 25738751
Influenza virus-infected cells respond with increased induction of interferon beta upon Staphylococcus aureus super-infection, however, subsequent interferon-stimulated gene expression are rather impaired due to a block of STAT1-STAT2 dimerization. PMID: 25293394
Paracrine signaling increases the number of cells that express Ifnb1 over time, calibrating the immune response to viral infection. PMID: 25670204
Data suggest that BRD4 (bromodomain containing 4) is essential for Toll-like receptor-stimulated interferon-beta (IFNB) gene transcription by permitting transcription factors to interact with the IFNB promoter in plasmacytoid dendritic cells. PMID: 25891802

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.