Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08398P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08398P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P18510
Target Symbol IL1RN
Synonyms DIRA; F630041P17Rik; ICIL 1RA; ICIL-1RA; ICIL1RA; IL-1ra; IL-1ra3; IL-1RN; IL1 inhibitor; IL1F3; IL1RA; IL1RA_HUMAN; IL1RN (IL1F3); IL1RN; Interleukin 1 receptor antagonist; Interleukin-1 receptor antagonist protein; Intracellular IL 1 receptor antagonist type II; Intracellular interleukin 1 receptor antagonist (icIL 1ra); IRAP; MGC10430; MVCD4; Type II interleukin 1 receptor antagonist
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Expression Range 26-177aa
Protein Length Full Length of Mature Protein
Mol. Weight 21.1kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Subcellular Location [Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Cytoplasm.; [Isoform 4]: Cytoplasm.
Database References
Associated Diseases Microvascular complications of diabetes 4 (MVCD4); Interleukin 1 receptor antagonist deficiency (DIRA)
Tissue Specificity The intracellular form of IL1RN is predominantly expressed in epithelial cells.

Gene Functions References

  1. PDE4B-deficient mice displayed an increased circulating IL-1Ra, suggesting a protective role of PDE4B inactivation in vivo. PMID: 28383060
  2. Interleukin 1 receptor antagonist*A2 might be a risk factor for progressive vitiligo. PMID: 29620037
  3. IL1-Ra is an independent predictor for adverse outcomes in patients with documented coronary artery disease. PMID: 29395365
  4. Carrying allele IL1RN*2 had a strong association with idiopathic recurrent spontaneous abortion (iRSA) in Mexican women; this polymorphism codifies for a low-function protein, which may allow for increased activity of IL-1 pro-inflammatory axis in iRSA. PMID: 29718011
  5. there was no sufficient evidence to support the association between IL-1RN 86-bp VNTR polymorphism and ischemic stroke (Meta-Analysis) PMID: 30075593
  6. Serum interleukin 1 receptor antagonist (IL1RA) and granzyme B (GZMB) levels were markedly increased in Crohn's disease (CD) patients, suggesting that these markers can serve as biomarkers to identify gut inflammation. PMID: 28972805
  7. this study reflects the importance of the IL1RN*2/2 genotype and its possible association in the pathogenesis of RA by regulation in the IL-1Ra production. PMID: 29226727
  8. Data show that the frequency of the IL-1 receptor antagonist (IL-1RN) 'T' allele of rs928940 was significantly lower in BC cases than in controls. PMID: 29047186
  9. TNF-alpha -857 C/C variant might represent protective effect against recurrent pregnancy loss (RPL) and the -857 C/T variant might be a genetic risk factor for the occurrence of RPL. Invariant differences in the prevalence of -511 C/T and -31 C/T polymorphisms and IL-1RN VNTR between RPL patients. PMID: 29949333
  10. IL-1ra concentrations were greater (p = 0.0018) in bone marrow aspirate samples (13,432 pg/mL) than in platelet-rich plasma (588 pg/mL). PMID: 26831858
  11. Studied role of IL-1Ra VNTR variant in susceptibility of temporomandibular joint disorders (TMD), and found the variant is significantly associated with TMD. PMID: 28612927
  12. Studied interleukin-1 receptor antagonist (IL-1Ra) and angiotensin-converting enzyme (ACE) I/D polymorphisms with regards to the susceptibility of patients to carpal tunnel syndrome. PMID: 28370589
  13. we did not observe an association between IL-1Ra 86 bp VNTR polymorphism in intron 2 and RPL patients (p > 0.05). Conclusion IL-1Ra VNTR polymorphism may not be a genetic factor for RPL PMID: 28593919
  14. The presence of the rs2234663 A2/A2 genotype in rheumatoid arthritis is associated with increased disease activity. PMID: 28342152
  15. The results suggest that although the 1068 G>A polymorphism of the P2RX7 gene is associated with an increased beta-cell function and IL-1Ra release in type 2 diabetes patients, the glycemic control is not significantly affected by the presence of this SNP. PMID: 29425823
  16. Studies used adult stem cells to engineer anatomically shaped, functional cartilage constructs capable of tunable and inducible expression of antiinflammatory molecules, specifically IL-1 receptor antagonist (IL-1Ra). PMID: 27432980
  17. No significant associations with RHD were found for the IL1RN rs447713 and CTLA4 rs3087243 SNPs. PMID: 27400406
  18. Reconstitution of ST2 (IL-1R4) specific for IL-33 activity; no suppression by IL-1Ra though a common chain IL-1R3 (IL-1RAcP) shared with IL-1 PMID: 27031441
  19. The polymorphic expression of IL-1RN (rs419598) gene may be associated with a reduced susceptibility to GAgP and GCP in populations of European descent. PMID: 29023524
  20. associations between the genetic variants and the LPS-induced IL-6, IL-8, IL-10, IL-1ra and TNF-alpha cytokine levels were not significant in the meta-analysis. This present study does not support a strong genetic effect of LPS-stimulated cytokine production; however, the potential for type II errors should be considered PMID: 23823136
  21. IL1RA intron 2 VNTR seems to be a genetic marker for overall adiposity status in Malaysian subjects. PMID: 28293435
  22. Increased IL-1Ra levels in women with polycystic ovary syndrome were largely explained by increasing adiposity. However, serum IL-1Ra concentrations predicted 2-h glucose levels independently of BMI suggesting that increased IL-1Ra may be associated with disturbed glucose metabolism. PMID: 27061312
  23. demonstrated that IL-1RN VNTR polymorphism might increase the risk of H. pylori infection, especially in Asians PMID: 28384207
  24. VNTR polymorphism associated with osteomyelitis development PMID: 28682145
  25. Polymorphisms of Il1rn were not significantly associated with bipolar I disorder in Iranian patients. PMID: 28129679
  26. Meta-analysis: Serum IL-1RA levels were positively associated with risk of cardiovascular disease. This association may at least partially reflect a response to triggers inducing subclinical inflammation, oxidative stress, and endothelial activation. PMID: 28428221
  27. Our work highlights the convenience and efficiency of this novel pH-sensitive fluorescent probe and reveals the new biological activity of staurosporine as an agonist for GLUT4 translocation and as an effective insulin additive analogue. PMID: 27769857
  28. African American women are at increased risk for early birth, particularly via the inflammatory pathway. Variants of the IL1RN gene, which encode the interleukin-1 receptor antagonist (IL-1Ra) protein, are implicated in early birth PMID: 28252571
  29. This study reveled that the association of IL1RN haplotype containing RN2 with FIRES, and showed a possible association of IL1RN rs4251981 G > A. PMID: 27538648
  30. We found that the mean mRNA levels of the proinflammatory cytokines IL-1beta, IL-6, TNF-alpha, their receptors, TNFR1, TNFR2, IL-1R1 and the antagonist IL-1RA were significantly increased in the lymphocytes of MDD patients compared with NC [normal control subjects].. PMID: 27138824
  31. C/T genotype of IL-1Ra +2018 prognosticates more aggressive disease in RA PMID: 27105431
  32. this study shows that IL-1Ra gene variants are associated with susceptibility to juvenile idiopathic arthritis in Iranian population PMID: 27717726
  33. The A2 allele of the interleukin 1 receptor antagonist VNTR polymorphism could be a protective factor for pre-eclampsia susceptibility. PMID: 26555681
  34. A2 allele and the combined IL-4 (low) -IL-1Ra (high) genotype might be genetic markers of susceptibility to frailty in Mexican elderly. PMID: 26646252
  35. This study demonstrated that thr frequency of the IL-1Ra/C allele at position Mspa-I 11100 was decreased significantly and the IL-1Ra/T frequency was significantly increased in patients with Febrile Seizures. PMID: 26500244
  36. Data indicate that levels of interleukin 1 receptor antagonist protein (IL-1-Ra) remain elevated for at least one year after storage at -80 degrees C. PMID: 26994310
  37. study showed that, IL-1RN allele 2, periodontal disease characterized with clinical attachment loss, previous preterm/low birth weight outcome (PLBW) and age could be important risk factors for PLBW PMID: 26445016
  38. Significant associations were found between Crohn's disease (CD) and minor NOD2 variants, as well as TLR4 299Gly, TNF-alpha G-308A, IL-6 G-174C and IL-1RN VNTR A2 variants, while ulcerative colitis (UC) was associated only with IL-1RN VNTR A2 variants. PMID: 26316104
  39. Suggest that IL-1RN rs315952 polymorphism may not be associated with susceptibility to Tourette syndrome in Chinese Han population. PMID: 26097611
  40. Serum IL1RA and IL2RA are predictors of event free survival in T-cell lymphoma. PMID: 26487586
  41. IL-1Ra can be a useful tool in the diagnosis of hepatic inflammation. PMID: 26612588
  42. This study shows a significant association between IL-1 RA allele distribution and febrile convulsions PMID: 26813462
  43. IL-1 genotypes do not seem to be good predictors of peri-implantitis in the great majority of smoking patients PMID: 26449434
  44. the lower expression of IL10 and the higher expression of IL1RA in Mo exposed to arthritic than to non-arthritic SF suggest that arthritic SF is mainly reducing the inflammatory responses in Mo. PMID: 26521731
  45. Results indicate there is a lack of association between the IL1RN VNTR polymorphisms and tuberculosis risk. [Meta-Analysis] PMID: 26330006
  46. The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with Familial Mediterranean Fever risk in the Turkish population. PMID: 26861613
  47. While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production. PMID: 26972847
  48. These data suggest that M. leprae upregulates IL-1Ra by a TOLLIP-dependent mechanism; inhibition of TOLLIP may decrease an individual's susceptibility to leprosy and offer a novel therapeutic target for IL-1-dependent diseases. PMID: 26610735
  49. This study emphasizes a positive association between IL1-Ra (VNTR) polymorphism and DM among Saudi children. This may suggest that (A2) allele may play important role in disease susceptibility. PMID: 26502861
  50. IL1-RN VNTR A1A3 genotype is associated with higher risk of RA. Among the cases, males who carry this genotype were more exposed to RA and had less erosive forms. PMID: 26003199

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Cytokines
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TGFB2.
Recombinant Human Transforming Growth Factor Beta-2 (TGFB2) Protein (His)
  • Molecule: TGFB2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Protein Fragment;
CAT#: BLC-11103P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd70 Antigen (CD70) Protein (His)
  • Molecule: CD70;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Extracellular Domain;
CAT#: BLC-10853P

Save $121
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL2.
Recombinant Human Interleukin-2 (IL2) Protein (GST)
  • Molecule: IL2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: GST;
  • Sequence: Full Length Protein;
CAT#: BLC-10775P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
  • Molecule: CCL18;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08214P

Save $141
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His-SUMO)
  • Molecule: PDGFB;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-07892P

Save $131
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase A (PPIA)
  • Molecule: PPIA;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-07883P

Save $206
Recently viewed