Recombinant Human Interleukin-11 (IL11), Active

Beta LifeScience SKU/CAT #: BLC-05418P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Interleukin-11 (IL11), Active

Beta LifeScience SKU/CAT #: BLC-05418P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-11 (IL11), Active is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL
Uniprotkb P20809
Target Symbol IL11
Synonyms Adipogenesis inhibitory factor; AGIF; IL 11; IL-11; Il11; IL11_HUMAN; Interleukin 11; Interleukin-11; Oprelvekin
Species Homo sapiens (Human)
Expression System Yeast
Tag Tag-Free
Complete Sequence GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Expression Range 23-199aa
Protein Length Partial
Mol. Weight 19 kDa
Research Area Immunology
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 2% Glycine, pH 7.2
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling'.
Subcellular Location Secreted.
Protein Families IL-6 superfamily
Database References

Gene Functions References

  1. the identification of a dysregulated miR-124/IL-11 axis helps elucidate mechanisms of breast cancer metastases to bone, uncovers new prognostic markers, and facilitates the development of novel therapeutic targets to treat and even prevent bone metastases of breast cancer. PMID: 29343249
  2. The results indicate that miR-23b regulates IL-11 and IL-11Ralpha expression, and it might act as an anti-oncogenic agent in the progression of Hepatocellular Carcinoma by directly downregulating IL-11 expression. PMID: 29901200
  3. It has been concluded that the renal cell carcinoma risk allele at 12p12.1 maps to rs7132434, a functional variant in an enhancer that upregulates BHLHE41 expression which, in turn, induces IL-11, a member of the IL-6 cytokine family. PMID: 27384883
  4. The results indicated that miR-124a has an important role as a tumor suppressor gene by targeting IL-11. PMID: 29286137
  5. Studied the role of ZEB1-AS1, and it's association with IL-11, in promoting STAT3 activation in B-lymphoblastic leukemia. PMID: 28861713
  6. Cancer-associated fibroblasts treated with cisplatin facilitate chemoresistance of lung adenocarcinoma through IL-11/IL-11R/STAT3 signaling pathway. PMID: 27922075
  7. results reveal a central role of IL-11 in fibrosis and we propose that inhibition of IL-11 is a potential therapeutic strategy to treat fibrotic diseases PMID: 29160304
  8. up-regulates GRP78 in the placenta PMID: 28487027
  9. The identification of the miR-206/TWF1/MKL1-SRF/IL11 signaling pathway sheds lights on the understanding of breast cancer initiation and progression, unveils new therapeutic targets, and facilitates innovative drug development to control cancer and block metastasis PMID: 27435395
  10. This review will discuss the available structural, functional, and bioinformatics knowledge concerning IL-11 and will summarize its relationship with several diseases PMID: 27312790
  11. Authors found a significant correlation between NRF2 and IL-11 status in breast cancer patients. Based on a recent report demonstrating that IL-11 is induced downstream of NRF2, authors examined the significance of IL-11 in NRF2-driven tumorigenesis with a newly established NRF2 addiction cancer model. PMID: 28714957
  12. this study shows that recombinant IL-11 is effective with tolerable adverse effects in Chinese patients with autoimmune thrombocytopenic purpura PMID: 27235596
  13. HMGA2 promoted colorectal cancer metastasis and epithelial-mesenchymal transition via activation of the FN1 and IL11/STAT3 signaling pathways. PMID: 26964871
  14. Together, these results suggest that the IL-11/STAT3 signaling pathway plays a critical role in human chronic atrophic gastritis , and may provide new targets to prevent and treat gastric cancer PMID: 27173233
  15. Proteolysis of the IL-11R represents a molecular switch that controls the IL-11 trans-signaling pathway which is the target in intestinal tumorigenesis, lung carcinomas, and asthma. PMID: 26876177
  16. IL-11 has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses, hence reducing the mortality in sepsis patients accompanied with thrombocytopenia. PMID: 26276375
  17. Results indicate that iterleukin-11 (IL11) is causal of Preeclampsia (PE) features in a mouse model and likely in women, and suggest potential of IL11 inhibition to rescue PE symptoms in women. PMID: 26655736
  18. The cross-talk between Th17 and interleukin 11 (IL-11+)CD4+ T cells may induce and amplify the autoimmune response in the early stage of multiple sclerosis (MS), and thus represent an attractive therapeutic target in this and other inflammatory diseases. PMID: 26452137
  19. Genetic variations of IL-11 may be associated with the risk of Hirschsprung disease and/or the mechanisms related to enteric nervous system development. PMID: 26172388
  20. IL-11 expression in breast cancer correlates with poor disease outcome PMID: 26209885
  21. data offer insight into the binding interactions of IL-11 with each of its receptors and the structural mechanisms underlying agonist and antagonist variants of the protein PMID: 25195742
  22. The highly specific IL-11 - S100P interaction occurring under physiologically relevant conditions should be taken into consideration upon development of the antineoplastics inhibiting IL-11 signaling. PMID: 26551460
  23. MTA2 overexpression enhances colony formation and tumor growth of gastric cancer cells, but not plays important role in cancer cell migration and metastasis. IL-11 is one of the downstream effectors of MTA2 in regulating gastric cancer cells growth PMID: 25929737
  24. IL-11 stimulates BSP gene transcription. PMID: 24633490
  25. The results prove the presence of the potentially functionally relevant IL-11 gene variants in the population of infertile women. PMID: 24635366
  26. High expression of interleukin-11 correlated with poor prognosis in clear-cell renal cell carcinoma patients. PMID: 25702890
  27. IL-11 is identified as a new Th17-promoting cytokine, because it induces a differentiation of naive CD4(+) T cells into Th17 cells, as well as expansion of Th17 memory cells. PMID: 25895532
  28. Low serum interleukin-11 are associated with pancreatic cancer. PMID: 25123265
  29. Pretreatment with rhIL-11 can reduce galactosamine-induced acute liver failure and protect the liver. PMID: 24817287
  30. In the presence of 100 ng/ml IL-11, GATA-3 transcript abundance rose up to ~85-fold of that measured in untreated cells, whereas T-bet transcripts were lowered merely to ~41% PMID: 24338248
  31. It Interleukin-11 (IL-11) is a pleiotropic cytokine that belongs to gp130 family. It plays a significant role in the synthesis and maturation of hematopoietic cells, inhibition of adipogenesis, regulation of embryo implantation, and trophoblasts invasion. PMID: 23631681
  32. DNA methylation of the CpG island in the IL-11 gene is associated with response of major depressive disorder patients to antidepressant drugs. PMID: 24002086
  33. IL-11 is associated with bone metastasis. PMID: 23813018
  34. IL11 given orally protects the intestinal mucosa from radiation damage PMID: 24219324
  35. IL-11 therefore drives a pathway that enhances HSPC radioresistance and radiation-induced B-cell malignancies, but is normally attenuated by the inhibitory adaptor Lnk. PMID: 24297922
  36. Solar simulted radiation-induced Il-11 may be involved in the photoaging-induced loss of facial subcutaneous fat. PMID: 23639700
  37. results suggest a two-step mechanism, whereby LfcinB induces TIMP-1 through an IL-11-dependent pathway involving transcription factor AP-1 and STAT3. PMID: 24036113
  38. induction of renal proximal tubule IL-11 is a critical intermediary in A1 adenosine receptor-mediated renal protection against acute ischemic kidney injury. PMID: 23813214
  39. the decreased ratio of IL-11/IL-17 might reflect an imbalance between the proinflammatory and anti-inflammatory cytokines in different periodontal diseases. PMID: 23226926
  40. An interleukin-6 family member, interleukin-11 is identified as a secondary target of twinfilin 1 in the microRNA-30c signalling pathway. PMID: 23340433
  41. Breast cancer cells may promote osteolysis in part by increasing the pool of osteoclast progenitor cells via tumor cell-derived IL-11. PMID: 23311882
  42. Enhanced production of IL-11 is associated with hepatocellular carcinoma metastasis to bone. PMID: 23307318
  43. IL11 is a hypoxia-inducible, VHL-regulated gene in human cancer cells and expression of IL11 mRNA is dependent, at least in part, on HIF-1. PMID: 23549086
  44. both the PI3K and Raf pathways are necessary for the expression of IL-11 in oncogenic Ras-mutated cells PMID: 23027619
  45. Data support the view that IL-11 is a key regulator of gastric damage acting to initiate chronic atrophic gastritis. PMID: 22180059
  46. IL-11 administration exhibits postconditioning effects through cardiac STAT3 activation, preventing myocardial ischemia-reperfusion injury. PMID: 22707562
  47. IL11 may be involved in endometrial cancer development PMID: 22614117
  48. Constructed a designer cytokine Hyper IL-11 (H11), which is exclusively composed of naturally existing components. It contains the full length sIL-11Ralpha connected with the mature IL-11 protein, and acts as an agonist on cells expressing the gp130 molec PMID: 22433466
  49. High Interleukin-11 is associated with multiple myeloma. PMID: 22289923
  50. Bovine lactoferrin administration prevented the progression of hepatic failure in human myofibroblasts and mice, and enhanced IL-11 and BMP2 expression in the small intestine. PMID: 21688123

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Cytokines
Recently viewed