Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00417P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00417P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Interleukin-12 Subunit Beta (IL12B) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P29460
Target Symbol IL12B
Species Homo sapiens (Human)
Expression System Yeast
Tag C-6His
Target Protein Sequence IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Expression Range 23-328aa
Protein Length Full Length of Mature Protein
Mol. Weight 36.8 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.; Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular Location Secreted.
Protein Families Type I cytokine receptor family, Type 3 subfamily
Database References
Associated Diseases Immunodeficiency 29 (IMD29); Psoriasis 11 (PSORS11)

Gene Functions References

  1. Effect of polymorphisms in IL-12B p40, IL-17A and IL-23 A/G genes on the response of psoriatic patients to narrowband UVB. PMID: 29763989
  2. showed that IL-12B A1188C (rs3212227) can contribute to the progression of the disease in the Czech population PMID: 30069682
  3. Study confirms an association between IL12B and IL23R genetic polymorphism and psoriasis vulgaris (with a protective effect of minor alleles). PMID: 29454820
  4. IL-12 B gene AA genotype presented more frequently in late stages of Hepatitis C virus chronically ill patients, while, CC genotype had no significant association with staging of liver disease and had low frequency especially in late stages of liver disease. PMID: 28595541
  5. Frequency of IL-12B AA (rs6871626) genotype was increased in Ankylosing Spondylitis patients. Interleukin IL-12B AA (rs6871626) gene polymorphisms could serve as promising biomarkers for diagnosis and prognosis in Ankylosing Spondylitis patients. PMID: 29200018
  6. The demonstrated allelic expression imbalance supports the idea that the IL12B risk haplotype confers susceptibility not only to Crohn's disease onset but to also relapse through increased IL12B mRNA expression. PMID: 28229296
  7. the present study IL-12B gene status was evaluated in 50 new sputum smear-positive pulmonary tuberculosis patients. PMID: 28697396
  8. The rs17860508 polymorphism in the IL12B promoter region may influence the risk of developing ovarian endometriosis by altering the endometrial expression of IL12B of in Northern Chinese women. PMID: 29738836
  9. The rs6871626 single nucleotide polymorphism in IL-12B is associated with the pathophysiology of Takayasu arteritis. PMID: 28874185
  10. Human neutrophil elastase is involved in transactivation of TLR4 through activation of DUOX-2/EGFR and synergistically enhances IL-12p40 production by macrophages stimulated with LPS. PMID: 27282560
  11. our results suggested a significant association between IL-12B 3'-UTR and rs6887695 SNPs and ADs. PMID: 27068848
  12. Single-nucleotide-polymorphisms of IL12B may be considered a high-risk factor for Takayasu arteritis in Chinese Han population PMID: 28160070
  13. IL-12B -1188 C allele may be a protective factor against asthma in East Asians PMID: 28287286
  14. The low expression of HDAC3 and overexpession of inflammatory cytokines (IL-18, IL-12 and TNF-alpha) in intrahepatic cholestasis of pregnancy may be involved in liver cell apoptosis and in the pathophysiology of the disease. PMID: 28697498
  15. Identification of PARP-1 as a unique regulator of Il12b transcription in response to inflammatory insults in an allele-differentiating manner PMID: 28219892
  16. Pre-incubation with IL-12 was able to restore IFN-gamma production and the cytotoxicity capacities of NK cells. This cytokine may therefore be considered as a potential treatment candidate in traumatic brain injury patients with immune suppression. PMID: 26387630
  17. Visceral leishmaniasis in two patients with IL-12p40 and IL-12Rbeta1 deficiencies PMID: 27873456
  18. NOD2 rs3135500 and IL12B rs1368439 SNPs were not genetic risk factors for colorectal cancer in the studied Iranian population. PMID: 27426943
  19. IL-12B gene polymorphisms were not related with rheumatoid arthritis (RA). However, rs6887695 was associated with RA in Asian patients PMID: 27155343
  20. Suggest Il12B SNPs as genetic marker of disease severity in Takayasu arteritis severity. PMID: 25783557
  21. The results of this study suggested that rs6887695 SNP in IL12B gene increase susceptibility to relapsing-remitting multiple sclerosis. PMID: 28276258
  22. these meta-analyses demonstrated that IL-12B rs3212227 and rs6887695 polymorphisms do not confer susceptibility to rheumatoid arthritis [data synthesis] PMID: 27312970
  23. Findings indicate that IL-12p40 + 1188A/C polymorphism as well as IL-12p70 protein levels may be associated with rheumatoid arthritis (RA) in the Polish population. PMID: 27896842
  24. The present meta-analysis suggests that the IL12B +1188A/C (rs3212227) polymorphism might be associated with genetic susceptibility to autoimmune diseases, such as type 1 diabetes, rheumatoid arthritis and Behcet disease, but not Graves disease and ankylosing spondylitis. PMID: 26915668
  25. this study shows that IL-12B gene polymorphism does not contribute to the risk of hepatocellular carcinoma on top of chronic hepatitis C virus infection in Egyptian patients PMID: 27819525
  26. this study has demonstrated (i) a significant association of -1082GG IL-10 genotype with susceptibility to autoimmune thyroid disease and (ii) the concomitant presence of IL-12B +1188CC and IL-10-1082 GG genotype contributes to the development and progression of Hashimoto's thyroiditis PMID: 27774749
  27. Il-12B SNPs have an association with anti-HBs Ab production after vaccination in healthy Korean infants. PMID: 28051794
  28. Our results reveal that the IL12A rs568408 variant may be a marker SNP for risk of both HBV clearance and HBV-related hepatocellular carcinoma development PMID: 26631030
  29. this study shows that the Il-12 genetic polymorphisms is associated with susceptibility to tuberculosis in patients and their household contacts in India PMID: 27108964
  30. High IL12 levels can inhibit Candida albicans colonizing the gastrointestinal tract of children and adolescents with diabetes mellitus type 1. PMID: 28127111
  31. this study shows that IL-12B gene polymorphism is genetic risk factor for systemic lupus erythematosus in the Polish population, and that it predicts disease phenotype PMID: 27059274
  32. analysis of cytokine gene polymorphisms suggests that IL-12 gene may play impact on specific pathogenesis of ophthalmopathy in Korean children with early onset autoimmune thyroid disease. PMID: 26850223
  33. IL-12 polymorphism rs3212227 might not be a critical risk factor for Preeclampsia in Chinese Han women. PMID: 27148908
  34. a tendency of a higher prevalence of the genotype IL-12p40 pro1.1 in systemic arthritis and in rheumatoid factor negative polyarthritis was observed but not significant PMID: 26667304
  35. genetic polymorphism is associated with psoriasis in the South Indian Tamils PMID: 26472011
  36. genetic polymorphism is associated with allergic rhinitis in Chinese patients PMID: 26663019
  37. The IL23R polymorphisms rs10889677, rs7517847, and the IL12B polymorphism rs3212227 are not associated with multiple sclerosis risk. PMID: 26000455
  38. IL-12 immunomodulation delays the onset of lethal peritoneal disease of ovarian cancer. PMID: 26430781
  39. variant IL-12p40 1188C/A genotype was AA (72.92%), AC (23.96%), and CC (3.13%%) in patients as compared to 65%, 30%, and 5%, respectively, in controls. PMID: 26516307
  40. the IL-12B rs3212227 AC and AC+CC genotypes are associated with rheumatoid arthritis risk in older patients,rheumatoid factor positive patients and anti-cyclic peptide antibodies negative patients PMID: 26375522
  41. High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells PMID: 26874795
  42. These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host. PMID: 26697414
  43. IL-12p40 response to in vitro stimulation in patients with Mendelian susceptibility to mycobacterial disease was below normal levels. PMID: 25201764
  44. 8 SNPs (rs10045431, rs11167764, rs3212227, rs6556412, rs6556416, rs6871626, rs6887695 and rs7709212) were genotyped in Han ankylosing spondylitis patients and controls. rs6871626 may be associated AS susceptibility and activity. PMID: 26103568
  45. Replicating the association of single-nucleotide polymorphisms in the TNFAIP3, IL12B and IL23R genes with psoriasis vulgaris, in subjects from different ethnic backgrounds, underlines their importance in the pathogenesis of the disease. PMID: 25406098
  46. balance of IL-23 vs IL-12/IL-27 signals into CD4(+) effector T cells determines whether tissue inflammation is perpetuated or resolves PMID: 24796719
  47. Compared with the IL-12B-AA genotype, CC and combined CC/AC genotypes were associated with a significant decreased risk of Hepatitis C virus infection in Chinese hemodialysis patients. PMID: 25613737
  48. These results show that IL-15 and IL-12 combination has the ability to expand the selective depletion of invariant natural killer T cells in vitro in HIV-infected individuals. PMID: 24748538
  49. The risk of gastric cardiac adenocarcinoma associated with the IL12B rs3212227 T > G polymorphism was evident among Chinese female patients and Chinese patients who never smoked or consumed alcoholic drinks. PMID: 24529168
  50. Based on these results, we believe that the increased levels of IL-12p40 and IL-16 are associated with an ongoing inflammatory response in obese individuals and could lead to the development of disease conditions related to obesity. PMID: 25710036

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed