Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active

Name: Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05333P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-20 Receptor Subunit Alpha (IL20RA) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.
Uniprotkb	Q9UHF4
Target Symbol	IL20RA
Synonyms	class II cytokine receptor ZCYTOR7; CRF2 8; CRF2-8; Cytokine receptor class II member 8; Cytokine receptor class-II member 8; Cytokine receptor family 2 member 8; I20RA_HUMAN; IL 20R alpha; IL 20R1; IL-20 receptor subunit alpha; IL-20R-alpha; IL-20R1; IL-20RA; IL20 Receptor alpha; IL20RA; Interleukin 20 receptor alpha chain; Interleukin 20 receptor, alpha; interleukin-20 receptor I; Interleukin-20 receptor subunit alpha; ZcytoR7
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK
Expression Range	30-250aa
Protein Length	Partial
Mol. Weight	26.3 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Protein Families	Type II cytokine receptor family
Database References	HGNC: 6003 OMIM: 605620 KEGG: hsa:53832 STRING: 9606.ENSP00000314976 UniGene: Hs.445868
Tissue Specificity	Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.

Gene Functions References

the DNA fragment containing the associated SNPs interacts through chromatin looping not only with TNFAIP3, but also with IL20RA, located 680 kb upstream. PMID: 27799070
IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy. PMID: 26977011
crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54% PMID: 22232181
IL-20RA polymorphisms may have a role in psoriasis PMID: 19926456
Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines. PMID: 19666410
forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2] PMID: 14580208
sensitivity to recombinant interleukin-26(IL-26) of various cell lines strictly correlated with the expression of IL-20 1 receptor and blocking antibodies against either IL-10 receptor 2 or IL-20 receptor 1 inhibited IL-26-dependent signal transduction PMID: 15178681
The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis was investigated. PMID: 18480827

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.