Recombinant Human Interleukin-23 (IL23A) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05323P

Greater than 95% as determined by SDS-PAGE.
Recombinant Human Interleukin-23 (IL23A) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05323P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | The Recombinant Human Interleukin-23 (IL23A) Protein (His), Active is produced by our Mammalian cell expression system. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 70-210 ng/ml. |
Uniprotkb | Q9NPF7&P29460 |
Target Symbol | IL23A |
Synonyms | IL 23 A; IL 23; IL 23 subunit alpha; IL 23A; IL 23p19; IL-23 subunit alpha; IL-23-A; IL-23p19; IL12B; IL23; Il23a; IL23A_HUMAN; IL23P19; interleukin 12B; Interleukin 23 alpha subunit p19; Interleukin 23 p19 subunit; interleukin 23 subunit alpha; interleukin 23 subunit p19; interleukin six; G CSF related factor; Interleukin-23 subunit alpha; Interleukin-23 subunit p19; JKA3 induced upon T cell activation; MGC79388; P19; SGRF |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-6His |
Complete Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP & IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Expression Range | 20-189aa & 23-328aa |
Mol. Weight | 19.5kDa&35.5kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered solution of PBS,100mM NaCl, pH 7.4 |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |