Recombinant Human Interleukin-6 Receptor Subunit Alpha (IL6R) Protein (His)

Name: Recombinant Human Interleukin-6 Receptor Subunit Alpha (IL6R) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10759P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Interleukin-6 Receptor Subunit Alpha (IL6R) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P08887
Target Symbol	IL6R
Synonyms	CD 126; CD126; CD126 antigen ; gp80; IL 6R 1; IL 6R alpha; IL 6R; IL-6 receptor alpha chain; IL-6 receptor subunit alpha; IL-6R 1; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL6Q; Il6r; IL6RA; IL6RA_HUMAN; IL6RQ; Interleukin 6 receptor; interleukin 6 receptor; alpha; Interleukin-6 receptor subunit alpha; Membrane glycoprotein 80; MGC30256
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Expression Range	20-365aa
Protein Length	Partial
Mol. Weight	40.5kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis. The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).; Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory (Probable). Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells.; Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity. The IL6:sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the proinflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases. In complex with IL6, is required for induction of VEGF production. Plays a protective role during liver injury, being required for maintenance of tissue regeneration. 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis.; Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity. The IL6:sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the proinflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases. In complex with IL6, is required for induction of VEGF production. Plays a protective role during liver injury, being required for maintenance of tissue regeneration. 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Soluble interleukin-6 receptor subunit alpha]: Secreted.
Protein Families	Type I cytokine receptor family, Type 3 subfamily
Database References	HGNC: 6019 OMIM: 147880 KEGG: hsa:3570 STRING: 9606.ENSP00000357470 UniGene: Hs.135087
Tissue Specificity	[Isoform 2]: Expressed in peripheral blood mononuclear cells and weakly found in urine and serum. 1%-20% of the total sIL6R in plasma is generated by alternative splicing.

Gene Functions References

The AA genotype for IL6R rs12083537 and CC for rs11265618 polymorphisms for may act as predictors of good response LDA. PMID: 27958380
a significant negative correlation of meprin beta expression and IL-6R levels on human granulocytes, providing evidence for in vivo function of this proteolytic interaction. PMID: 28276471
IL-6/soluble IL-6R differentially regulate RANKL-induced osteoclast differentiation and activity through modulation of NF-kappaB, ERK and JNK signaling pathways. PMID: 28128332
Gene IL6R polymorphic variant rs2228145(C>A) seems to be involved in genetic predisposition of the population of Karelia to nonalcoholic steatohepatitis. PMID: 29797122
IL-6R was shown to be an independent prognostic factor for patients with cervical cancer. PMID: 28741286
Frequency of IL-6R TT (rs4129267) genotype was increased in Ankylosing Spondylitis patients. Interleukin IL-6R (rs4129267) gene polymorphisms could serve as promising biomarkers for diagnosis and prognosis in Ankylosing Spondylitis patients. PMID: 29200018
In a genome-wide meta-analysis of 20,550 patients with Crohn's disease (CD), 17,647 patients with ulcerative colitis (UC), and more than 40,000 individuals without IBD (controls), study found that rs2228145 (scaled to a 2-fold increase in s-IL6R) was associated with reduced risk of CD or UC.[meta-analysis] PMID: 29775600
Analysis of the IL-6 (-572G/C) polymorphism revealed a higher level of the GG genotype in the patients with Celiac Disease compared with the control group. PMID: 28928101
miR-124, IL-6R and STAT3 are involved in the process of sulforaphane-improved CDDP chemotherapy efficacy by targeting cancer stem cell-like properties PMID: 27824145
High IL6-R expression is associated with cisplatin resistance in epithelial ovarian cancer. PMID: 28388577
sIL-6R may be a useful biomarker to assess insulin resistance among morbidly obese subjects PMID: 28346858
Study identified variants associated with the age of onset of Alzheimer's disease in APOE varepsilon4 carriers. Across five datasets, p.D358A had a meta P = 3 x10-4 and an odds ratio = 1.3, 95% confidence interval 1.12 -1.48. Study suggests that a common coding region variant of the IL-6 receptor results in neuroinflammatory changes that may influence the age of onset of Alzheimer's disease in APOE varepsilon4 carriers. PMID: 28106546
IL-6R protein expression on plasma membrane of ovarian cancer cells mediates enhanced cell migration/invasiveness in response to IL6 in ascites. PMID: 27825119
IL6R protein levels were higher in bone than in lymph node and visceral metastases of castration-resistant prostate cancer. PMID: 27344294
IL-6R CC genotype was associated with a three times greater concussion risk and APOE4 with a 40% lower risk in college athletes PMID: 28918391
In the present study, the authors show that deletion of a triple serine (3S) motif (Ser-359 to Ser-361) adjacent to the cleavage site is sufficient to prevent IL-6R cleavage by ADAM17, but not ADAM10. We find that the impaired shedding is caused by the reduced distance between the cleavage site and the plasma membrane. PMID: 27151651
IL6R SNPs are associated with simultaneously high CRP, LDL and ApoB levels. PMID: 28769070
CLL cells with higher CD126 expression are more resistant to treatment. PMID: 26712690
The mRNA expression of IL6R was inversely correlated with miR-449a in osteosarcoma tissues. In addition, JAK1/STAT3 signaling pathway was regulated by circ_0009910/miR-449a/IL6R axis. PMID: 29117539
IL-6 receptor blockade has an effect on high-sensitivity troponin T and NT-proBNP in rheumatoid arthritis PMID: 27744141
Enterovirus 71 antagonizes the antiviral activity of host STAT3 and IL-6R with partial dependence on virus-induced miR-124. PMID: 29120300
we present evidence for the role of M2 phenotype TAM in IL-6 receptor-mediated signals, particularly tyrosine phosphorylation of STAT3, responsible for the prosurvival adaptation of tumor cells to hypoxia. PMID: 26705936
3 SNPs (rs4329505 and rs4845626 in interleukin 6 receptor [IL6R] and rs1422794 in a disintegrin and metalloproteinase domain 19 [ADAM19]) were associated with a lower risk of suffering the most severe stages of the disease. PMID: 27078193
The expression of STOML2, a gene that plays a key role in mitochondrial function and T-cell activation, is associated with both IL-6 signaling and asthma risk. PMID: 26932604
IL6R is downregulated in the tissues from colonic biopsies taken from Ulcerative Colitis patients.Thus, expression levels of IL6R can be used as markers of disease or disease progression in Ulcerative Colitis patients. PMID: 28774868
expanded CD8(+)IL-6Ralpha(low) EM T cells have roles in coronary artery disease through their pro-inflammatory and highly cytotoxic capacities PMID: 27062409
Both gingival crevicular fluid sIL-6R and calprotectin concentrations are significant biomarkers in the evaluation of periodontal inflammation PMID: 27810997
Our results argued that increased expression of sIL6R from myeloid cells and subsequent c-Maf induction were adverse events for counteracting tumor-specific Th1 generation. Overall, this work provides a mechanistic rationale for sIL6R targeting to improve the efficacy of T-cell-mediated cancer immunotherapy PMID: 28235765
These results demonstrate a novel physiologic role for a disintegrin and metalloprotease 17 in regulating murine IL-6 signals during inflammatory processes. PMID: 26561568
this study show that soluble IL-6R is infiltrating from the circulation in an ADAM17-independent process and is involved in the controlled resolution of an acute inflammatory episode PMID: 27698010
the sIL-6R/p28 fusion protein (FP) upregulated IFN-lambda1 expression by increasing the binding abilities of c-Fos and activating transcription factor 1 to the IFN-lambda1 promoter via the p38 MAPK signaling pathway; results demonstrate the important role of sIL-6R/p28 FP in mediating virus-induced type III IFN production PMID: 27527594
Soluble IL-6R levels appeared to be significantly higher irrespective of disease activity in patients with large-vessel vasculitis. PMID: 28466804
glycosylation is an important regulator for soluble IL-6R generation. PMID: 28060820
IL-6R rs2228145 genotype was associated with decreased risk of gastric cancer for the individuals with negative and positive Helicobacter pylori infection. PMID: 28442395
The here presented data demonstrate that miR-451 may function as a potential suppressor of tumor growth, migration and angiogenesis in osteosarcoma via down-regulating IL 6R. PMID: 27908732
DNA hypomethylation of IL-6 gene measured in blood leukocytes was associated with increased risk of ischemic heart disease. PMID: 26981890
minor allele, with the difference eliminated upon addition of tocilizumab. In conclusion, there is evidence that neutrophils may be an important source of sIL-6R in the lungs, and the Asp358Ala variant may have pro-inflammatory effects in lung cells.d However, we were unable to identify evidence for aisease PMID: 28334838
MiR-451 may function as a potential suppressor of tumor angiogenesis in HCC by targeting IL-6R-STAT3-VEGF signaling, suggesting. PMID: 27461244
high levels of IL-6R expression in spindle-shaped stromal cells, not associated with the vasculature, could be used to identify early breast cancer patients with poor outcomes. PMID: 27460086
No significant association between IL6R rs2228145 and dementia. PMID: 26725994
Rs4845617 of the IL-6R gene is associated with the neurologic status of Korean patients with ischemic stroke. PMID: 26955245
Data suggest domains D1-D3, which contain cytokine binding module, determine which cytokine can activate interleukin-6 or interleukin-11 alpha-receptor subunits; stalk, transmembrane, or intracellular regions do not participate in ligand selectivity. PMID: 26551279
Anti-IL-6R antibody prevented the early loss of intrahepatic islet grafts mediated by HMGB1-induced immune activation after islet transplantation. PMID: 25058889
While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population. PMID: 26782593
Authors identified miR-125a as a direct regulator of IL-6R, and the genotype of rs12976445 might be a novel predictor of the development of DN in DM. PMID: 26563755
results provide evidence that two IL6R gene polymorphisms rs2228145 C and rs12083537 G are associated with poor lung function in patients with asthma. Furthermore, the rs2228145 A-C variant is associated with levels of sIL-6R and IgE. PMID: 26997259
miR-125a-5p directly targets IL-6R and STAT3 expression in HEK-293T cells. PMID: 26424054
High serum IL-6R levels were associated with Chronic Spontaneous Urticaria. PMID: 26699882
findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation PMID: 26329582
Interleukin-6 is strongly affected by factors associated with obesity accounting for its lability and responsiveness to diet, life style and contemporaneous events. PMID: 26086344

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.