Recombinant Human LGALS14 Protein
Beta LifeScience
SKU/CAT #: BLA-1650P
Recombinant Human LGALS14 Protein
Beta LifeScience
SKU/CAT #: BLA-1650P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8TCE9 |
Synonym | Charcot Leyden crystal protein 2 Charcot-Leyden crystal protein 2 CLC2 Gal 14 Gal-14 Gal14 Galectin 14 Galectin-14 Galectin14 Lectin galactoside binding soluble 14 LGALS14 MGC22235 Placental protein 13 like Placental protein 13 like protein Placental protein 13-like PPL13 PPL13_HUMAN |
Description | Recombinant Human LGALS14 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPI LTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEK CYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVL RDISLTRVLISD |
Molecular Weight | 19 kDa |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |