Recombinant Human LGALS3BP Protein
Beta LifeScience
SKU/CAT #: BLA-1651P
Recombinant Human LGALS3BP Protein
Beta LifeScience
SKU/CAT #: BLA-1651P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q08380 |
Synonym | 90K 90K MAC 2 BP Basement membrane autoantigen p105 BTBD17B Galectin 3 binding protein Galectin-3-binding protein L3 antigen Lectin galactoside binding soluble 3 binding protein Lectin galactoside-binding soluble 3-binding protein LG3BP_HUMAN LGALS3BP M2BP Mac 2 binding protein Mac 2 BP Mac-2 BP Mac-2-binding protein Mac2 BP MAC2BP Serum protein 90K TANGO10B Transport and golgi organization 10 homolog B Tumor associated antigen 90K Tumor-associated antigen 90K |
Description | Recombinant Human LGALS3BP Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCD NLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASL ADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQ RGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAE CVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAIL LPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLT EDTYKPRIYTSPTWSAFVTDSSWSARKSQLVYQSRRGPLVKYSSDYFQAP SDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCWNYGFSCSSDE LPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAATPSALDT NSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD |
Molecular Weight | 90 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells. |
Subcellular Location | Secreted. Secreted, extracellular space, extracellular matrix. |
Database References | |
Tissue Specificity | Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts. |
Gene Functions References
- Serum M2BP might contribute to the inflammatory process in systemic lupus erythematosus. PMID: 29233037
- M2BP inhibits both HIV-1 Env processing and virion production.M2BP traps HIV-1 Gag to vimentin filaments to inhibit the transportation of HIV-1 Gag to the plasma membrane. PMID: 27604950
- Results showed that 90K destabilizes E-cadherin and affects cell adhesion and invasion in subconfluent cancer cells via dissociation of the E-cadherin-p120-catenin complex, suggesting that 90K drives less confluent tumor cells into the early steps of cancer metastasis. PMID: 29207493
- Low LGALS3BP expression is associated with HIV infections. PMID: 29743357
- Data suggest that serum levels of RBP4 and LGAL3BP are up-regulated after menopause when complicated by NAFLD (non-alcoholic fatty liver disease); RBP4 and LGAL3BP may serve as biomarkers of NAFLD in postmenopausal women. (RBP4 = retinol binding protein 4; LGAL3BP = galectin-3 binding protein) PMID: 29679552
- Elevated plasma M2BP levels might be predictive of unstable plaque and were associated independently with poor cardiovascular outcomes in patients with acute coronary syndromes. PMID: 28731888
- Serum Mac-2-binding protein expression predicts disease severity in chronic hepatitis C patients. PMID: 28811008
- A higher pre-treatment WFA+-M2BP level was associated with an increased risk of HCC development in patients with undetectable HBV DNA under NA therapy. PMID: 28537900
- the combination of 17-AAG and PI3K/Akt inhibitor would effectively suppress acquired resistance to 17-AAG. In conclusion, targeting of LGALS3BP-mediated-specific survival signaling pathway in resistant cells may provide a novel therapeutic model for the cancer therapy. PMID: 28336809
- serum M2BP may reflect silent atherosclerosis in apparently healthy subjects PMID: 27344370
- the serum M2BP-adiponectin complex is elevated in men with coronary artery disease PMID: 27588936
- WFA + -M2BP from hepatic stellate cells induces Mac-2 expression in Kupffer cells, which in turn activates hepatic stellate cells to be fi brogenic. PMID: 28008658
- The Mac-2BP may have a role in regulating the extracellular spreading and storage of the Wnts, thereby modulating their bioavailability and stability. PMID: 28756229
- Our present results highlight the action of 90K on promoting degradation of mutant beta-catenin lacking the phosphorylation sites in the N-terminus. PMID: 27668402
- Serum M2BP can be a useful biomarker for the diagnosis of pancreatic ductal adenocarcinoma and the prediction of disease progression since it potentially reflects altered pro-oncologic glycosylation enzymes PMID: 27665173
- In this study, we addressed this question by analysing sLex expression together with two glycoproteins (BST-2 and LGALS3BP).Concomitant high expression of BST-2 with sLex defined a sub-group of patients with ER-negative tumours displaying higher risks of liver and brain metastasis and a 3-fold decreased survival rate PMID: 27176937
- Results showed that in acute febrile phase, galectin-9 and galectin-3BP were induced in dengue patients compared to healthy controls suggesting that both molecules might be important inflammatory mediators in acute dengue virus infection. PMID: 27240351
- 90K/Mac-2BP correlated with the size of colorectal cancer. PMID: 26448934
- Results provide direct evidence for the involvement of CALU and LGALS3BP as potential negative regulators in the virus-triggered induction of the typeI interferons. PMID: 26124285
- These results provide evidence that low expression of LGALS3BP participates in malignant progression of colorectal cancer. PMID: 26219351
- Post-Tx WFA+-M2BP (> 2.0 COI) is associated with the risk for development of HCC among patients with SVR. The WFA+-M2BP values could be a new predictor for HCC after SVR. PMID: 26070204
- Serum Mac-2 binding protein levels as a novel diagnostic biomarker for prediction of disease severity and nonalcoholic steatohepatitis PMID: 23775887
- findings may help clarify the molecular mechanism of the tumor-suppressive effect through down-regulation of LGALS3BP by miR-596 in Oral Squamous Cell Carcinoma PMID: 26502662
- Studied levels of galectin-3 binding protein in milk from 247 HIV-infected Zambian mothers. Levels were higher in those mothers who transmitted HIV through breast-feeding. PMID: 23899964
- LGALS3BP-mediated integrin activation results into signal transmission via Akt, JNK and the Ras cascade via the Raf-ERK axis while p38 activity is kept at baseline levels PMID: 24362527
- Gal-3BP levels in patients with haemorrhagic fever with renal syndrome correlated with increased complement activation and with clinical variables reflecting the severity of acute hantavirus infection. PMID: 25013204
- These findings suggest a novel immunoinhibitory function for LGALS3BP that might be important for immune evasion of tumor cells during cancer progression. PMID: 25320078
- Thus, 90K constitutes a novel antiviral factor that reduces the particle infectivity of HIV-1, involving interference with the maturation and incorporation of HIV-1 Env molecules into virions. PMID: 24156545
- LGALS3BP is enriched in human ovarian carcinoma exosomes. PMID: 24302979
- Recombinant 90K showed an apparent molecular weight of approximately 78kDa which was much smaller than that ( approximately 97kDa) of the natural 90K. It is suggested that recombinant 90K has small N-glycans with about half the molecular weight of N-glycans of natural 90K. PMID: 23830458
- The expression of serum Mac-2 binding protein is a potential therapeutic target and biomarker for lung cancer. PMID: 23184915
- LGALS3BP suppresses assembly of centriolar substructures. PMID: 23443559
- LGALS3BP induces vascular endothelial growth factor in human breast cancer cells and promotes angiogenesis. PMID: 22864925
- MIR596 is frequently observed in oral squamous cell carcinoma and regulates expression of LGAL3BP. PMID: 23233740
- breast cancer cells express Mac-2BP as a novel E-selectin ligand, potentially revealing a new prognostic and therapeutic target for breast cancer PMID: 22970241
- Single nucleotide polymorphism (SNP) of LGALS3BP gene (found in NCBI) database are not characteristic for papillary thyroid cancer, follicular adenomas and nodular goiter PMID: 17091456
- results show that NF-kappaB regulated the expression of G3BP and that G3BP increased the adhesion of T47D breast cancer cells to fibronectin PMID: 22447108
- Adeno-associated virus type 6 interacts with G3BP in human and dog sera but not in macaque serum. PMID: 22496229
- There is no difference in Gal-3 expression in peripheral blood lymphocytes in patients with papillary thyroid cancer PMID: 17091455
- LGALS3BP gene was expressed by neuroblatoma cell lines and patients' neuroblasts PMID: 21660451
- serum changes of three glycoproteins, galectin-3 binding protein, insulin-like growth factor binding protein 3, and thrombospondin 1, was associated with the development of hepatocellular carcinoma PMID: 21474793
- Mac-2BP was detected as a predominant DC-SIGN ligand expressed on some primary colorectal cancer tissues PMID: 21515679
- These results suggest that galectin-3 binding protein may be a potential therapeutic target for treatment of, at least, colon cancer patients with high expression of galectin-3 binding protein. PMID: 21094132
- Serum Mac-2BP does not appear to originate in the prostate and it is unlikely that Mac-2BP can be used for the differential diagnosis of prostate cancer versus benign prostatic hyperplasia. PMID: 20583127
- Initial assessment showed that serum Mac-2BP is significantly elevated in patients with NET (neuroendocrine tumors) and is expressed by the majority of NET tissues. PMID: 20019050
- structural and functional properties of M2BP PMID: 11867635
- Expression of 90K (Mac-2 BP) correlates with distant metastasis and predicts survival in stage I non-small cell lung cancer patients. PMID: 11980646
- REVIEW: role in tumor progression and metastasis PMID: 14758079
- 90K plays an important role in the maintenance of an appropriate level of immune response. PMID: 15231701
- Elevated Mac-2 binding protein is associated with distant metastasis and higher tumor stage in gastric cancer PMID: 17131321