Recombinant Human LGALS3BP Protein

Beta LifeScience SKU/CAT #: BLA-1651P

Recombinant Human LGALS3BP Protein

Beta LifeScience SKU/CAT #: BLA-1651P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q08380
Synonym 90K 90K MAC 2 BP Basement membrane autoantigen p105 BTBD17B Galectin 3 binding protein Galectin-3-binding protein L3 antigen Lectin galactoside binding soluble 3 binding protein Lectin galactoside-binding soluble 3-binding protein LG3BP_HUMAN LGALS3BP M2BP Mac 2 binding protein Mac 2 BP Mac-2 BP Mac-2-binding protein Mac2 BP MAC2BP Serum protein 90K TANGO10B Transport and golgi organization 10 homolog B Tumor associated antigen 90K Tumor-associated antigen 90K
Description Recombinant Human LGALS3BP Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCD NLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASL ADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQ RGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAE CVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQGYCASLFAIL LPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPM MLPEELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLT EDTYKPRIYTSPTWSAFVTDSSWSARKSQLVYQSRRGPLVKYSSDYFQAP SDYRYYPYQSFQTPQHPSFLFQDKRVSWSLVYLPTIQSCWNYGFSCSSDE LPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGWKAATPSALDT NSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
Molecular Weight 90 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
Subcellular Location Secreted. Secreted, extracellular space, extracellular matrix.
Database References
Tissue Specificity Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts.

Gene Functions References

  1. Serum M2BP might contribute to the inflammatory process in systemic lupus erythematosus. PMID: 29233037
  2. M2BP inhibits both HIV-1 Env processing and virion production.M2BP traps HIV-1 Gag to vimentin filaments to inhibit the transportation of HIV-1 Gag to the plasma membrane. PMID: 27604950
  3. Results showed that 90K destabilizes E-cadherin and affects cell adhesion and invasion in subconfluent cancer cells via dissociation of the E-cadherin-p120-catenin complex, suggesting that 90K drives less confluent tumor cells into the early steps of cancer metastasis. PMID: 29207493
  4. Low LGALS3BP expression is associated with HIV infections. PMID: 29743357
  5. Data suggest that serum levels of RBP4 and LGAL3BP are up-regulated after menopause when complicated by NAFLD (non-alcoholic fatty liver disease); RBP4 and LGAL3BP may serve as biomarkers of NAFLD in postmenopausal women. (RBP4 = retinol binding protein 4; LGAL3BP = galectin-3 binding protein) PMID: 29679552
  6. Elevated plasma M2BP levels might be predictive of unstable plaque and were associated independently with poor cardiovascular outcomes in patients with acute coronary syndromes. PMID: 28731888
  7. Serum Mac-2-binding protein expression predicts disease severity in chronic hepatitis C patients. PMID: 28811008
  8. A higher pre-treatment WFA+-M2BP level was associated with an increased risk of HCC development in patients with undetectable HBV DNA under NA therapy. PMID: 28537900
  9. the combination of 17-AAG and PI3K/Akt inhibitor would effectively suppress acquired resistance to 17-AAG. In conclusion, targeting of LGALS3BP-mediated-specific survival signaling pathway in resistant cells may provide a novel therapeutic model for the cancer therapy. PMID: 28336809
  10. serum M2BP may reflect silent atherosclerosis in apparently healthy subjects PMID: 27344370
  11. the serum M2BP-adiponectin complex is elevated in men with coronary artery disease PMID: 27588936
  12. WFA + -M2BP from hepatic stellate cells induces Mac-2 expression in Kupffer cells, which in turn activates hepatic stellate cells to be fi brogenic. PMID: 28008658
  13. The Mac-2BP may have a role in regulating the extracellular spreading and storage of the Wnts, thereby modulating their bioavailability and stability. PMID: 28756229
  14. Our present results highlight the action of 90K on promoting degradation of mutant beta-catenin lacking the phosphorylation sites in the N-terminus. PMID: 27668402
  15. Serum M2BP can be a useful biomarker for the diagnosis of pancreatic ductal adenocarcinoma and the prediction of disease progression since it potentially reflects altered pro-oncologic glycosylation enzymes PMID: 27665173
  16. In this study, we addressed this question by analysing sLex expression together with two glycoproteins (BST-2 and LGALS3BP).Concomitant high expression of BST-2 with sLex defined a sub-group of patients with ER-negative tumours displaying higher risks of liver and brain metastasis and a 3-fold decreased survival rate PMID: 27176937
  17. Results showed that in acute febrile phase, galectin-9 and galectin-3BP were induced in dengue patients compared to healthy controls suggesting that both molecules might be important inflammatory mediators in acute dengue virus infection. PMID: 27240351
  18. 90K/Mac-2BP correlated with the size of colorectal cancer. PMID: 26448934
  19. Results provide direct evidence for the involvement of CALU and LGALS3BP as potential negative regulators in the virus-triggered induction of the typeI interferons. PMID: 26124285
  20. These results provide evidence that low expression of LGALS3BP participates in malignant progression of colorectal cancer. PMID: 26219351
  21. Post-Tx WFA+-M2BP (> 2.0 COI) is associated with the risk for development of HCC among patients with SVR. The WFA+-M2BP values could be a new predictor for HCC after SVR. PMID: 26070204
  22. Serum Mac-2 binding protein levels as a novel diagnostic biomarker for prediction of disease severity and nonalcoholic steatohepatitis PMID: 23775887
  23. findings may help clarify the molecular mechanism of the tumor-suppressive effect through down-regulation of LGALS3BP by miR-596 in Oral Squamous Cell Carcinoma PMID: 26502662
  24. Studied levels of galectin-3 binding protein in milk from 247 HIV-infected Zambian mothers. Levels were higher in those mothers who transmitted HIV through breast-feeding. PMID: 23899964
  25. LGALS3BP-mediated integrin activation results into signal transmission via Akt, JNK and the Ras cascade via the Raf-ERK axis while p38 activity is kept at baseline levels PMID: 24362527
  26. Gal-3BP levels in patients with haemorrhagic fever with renal syndrome correlated with increased complement activation and with clinical variables reflecting the severity of acute hantavirus infection. PMID: 25013204
  27. These findings suggest a novel immunoinhibitory function for LGALS3BP that might be important for immune evasion of tumor cells during cancer progression. PMID: 25320078
  28. Thus, 90K constitutes a novel antiviral factor that reduces the particle infectivity of HIV-1, involving interference with the maturation and incorporation of HIV-1 Env molecules into virions. PMID: 24156545
  29. LGALS3BP is enriched in human ovarian carcinoma exosomes. PMID: 24302979
  30. Recombinant 90K showed an apparent molecular weight of approximately 78kDa which was much smaller than that ( approximately 97kDa) of the natural 90K. It is suggested that recombinant 90K has small N-glycans with about half the molecular weight of N-glycans of natural 90K. PMID: 23830458
  31. The expression of serum Mac-2 binding protein is a potential therapeutic target and biomarker for lung cancer. PMID: 23184915
  32. LGALS3BP suppresses assembly of centriolar substructures. PMID: 23443559
  33. LGALS3BP induces vascular endothelial growth factor in human breast cancer cells and promotes angiogenesis. PMID: 22864925
  34. MIR596 is frequently observed in oral squamous cell carcinoma and regulates expression of LGAL3BP. PMID: 23233740
  35. breast cancer cells express Mac-2BP as a novel E-selectin ligand, potentially revealing a new prognostic and therapeutic target for breast cancer PMID: 22970241
  36. Single nucleotide polymorphism (SNP) of LGALS3BP gene (found in NCBI) database are not characteristic for papillary thyroid cancer, follicular adenomas and nodular goiter PMID: 17091456
  37. results show that NF-kappaB regulated the expression of G3BP and that G3BP increased the adhesion of T47D breast cancer cells to fibronectin PMID: 22447108
  38. Adeno-associated virus type 6 interacts with G3BP in human and dog sera but not in macaque serum. PMID: 22496229
  39. There is no difference in Gal-3 expression in peripheral blood lymphocytes in patients with papillary thyroid cancer PMID: 17091455
  40. LGALS3BP gene was expressed by neuroblatoma cell lines and patients' neuroblasts PMID: 21660451
  41. serum changes of three glycoproteins, galectin-3 binding protein, insulin-like growth factor binding protein 3, and thrombospondin 1, was associated with the development of hepatocellular carcinoma PMID: 21474793
  42. Mac-2BP was detected as a predominant DC-SIGN ligand expressed on some primary colorectal cancer tissues PMID: 21515679
  43. These results suggest that galectin-3 binding protein may be a potential therapeutic target for treatment of, at least, colon cancer patients with high expression of galectin-3 binding protein. PMID: 21094132
  44. Serum Mac-2BP does not appear to originate in the prostate and it is unlikely that Mac-2BP can be used for the differential diagnosis of prostate cancer versus benign prostatic hyperplasia. PMID: 20583127
  45. Initial assessment showed that serum Mac-2BP is significantly elevated in patients with NET (neuroendocrine tumors) and is expressed by the majority of NET tissues. PMID: 20019050
  46. structural and functional properties of M2BP PMID: 11867635
  47. Expression of 90K (Mac-2 BP) correlates with distant metastasis and predicts survival in stage I non-small cell lung cancer patients. PMID: 11980646
  48. REVIEW: role in tumor progression and metastasis PMID: 14758079
  49. 90K plays an important role in the maintenance of an appropriate level of immune response. PMID: 15231701
  50. Elevated Mac-2 binding protein is associated with distant metastasis and higher tumor stage in gastric cancer PMID: 17131321

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed