Recombinant Human LIFR Protein

Beta LifeScience SKU/CAT #: BLA-0795P

Recombinant Human LIFR Protein

Beta LifeScience SKU/CAT #: BLA-0795P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P42702
Synonym CD118 CD118 antigen FLJ98106 FLJ99923 Leukemia inhibitory factor receptor Leukemia inhibitory factor receptor alpha LIF R LIF receptor LIF-R Lifr LIFR_HUMAN SJS2 STWS SWS
Description Recombinant Human LIFR Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLE KTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNL SADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTL NGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNI SWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDG ENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETH DLKEIICSWNPGRVTALVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQ LLFQMLPNQEIYNFTLNAHNPLGRSQSTILVNITEKVYPHTPTSFKVKDI NSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQRNVTIKGVENSSYLV ALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPDTWRE WSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKA EIRLDKNDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGIL LTWHYDPNMTCDYVIKWCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPG IRYNFFLYGCRNQGYQLLRSMIGYIEELAPIVAPNFTVEDTSADSILVKW EDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGRSDIKVKNITDISQK TLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENS
Molecular Weight 116 kDa
Purity >96% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Measured by its ability to inhibit LIF-dependent proliferation of TF1 Human erythroleukemic cells.The ED50 for this effect is typically 5-10 µg/ml in the presence of 0.3 ng/ml of recombinant Human LIF.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.
Subcellular Location [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families Type I cytokine receptor family, Type 2 subfamily
Database References
Associated Diseases Stueve-Wiedemann syndrome (STWS)

Gene Functions References

  1. High levels of LIFR in colorectal cancer (CRC) facilitated proliferation and migration of endothelial cells, resulting in an increase in angiogenic activity. Moreover, IL-8 was found to play a role in the LIFR induced angiogenesis. IL-8 levels were correlated with LIFR levels in CRC tissues, whereas depletion of IL-8 led to a reduced angiogenic activity of LIFR in CRC cells. PMID: 29751081
  2. These data indicate that miR-377-3p suppressed adipogenesis of human bone marrow mesenchymal stem cells by targeting LIFR, which provides novel insights into the molecular mechanism of miRNA-mediated cellular differentiation. PMID: 29959592
  3. High expression of LIFR is associated with preeclampsia. PMID: 29363569
  4. LIFR attenuates tumor metastasis by suppressing YAP expression, suggesting that LIFR may serve as a potential target for clear cell renal cell carcinoma treatment. PMID: 29902078
  5. Data show that lncRNA-CTD-2108O9.1 represses metastasis by targeting leukemia inhibitory factor receptor (LIFR). PMID: 29603493
  6. Significant reduction in LIFR expression and the reduced activation of subsequent signaling strongly suggest a working model of how the implantation markers, LIF, may affect the endometrium of patients with adenomyosis. PMID: 27903796
  7. Expression of cancer-specific glycan epitopes represents an excellent opportunity for diagnostics and potentially specific detection of tumors. Here, we report four proteins (LIFR, CE350, VP13A, HPT) found in sera from pancreatic cancer patients carrying aberrant glycan structures as compared to those of controls. PMID: 28244758
  8. Authors demonstrate heterozygous novel or rare LIFR mutations in 3.3% of CAKUT patients, and provide evidence that Lifr deficiency and deactivating LIFR mutations cause highly similar anomalies of the urogenital tract in mice and humans. PMID: 28334964
  9. LIFR inhibited the expression of beta-catenin. PMID: 27375070
  10. The Leukemia Inhibitory Factor Receptor Gene Is a Direct Target of RUNX1 PMID: 26060100
  11. We report the case of a girl with Stuve-Wiedemann syndrome confirmed on molecular analysis. PMID: 25868946
  12. The C65S mutant LIFR showed altered glycosylation and an elevated expression level that might be attributed to a slow turnover of the mutant form. PMID: 26285796
  13. High LIFr expression stimulates melanoma cell migration and is associated with unfavorable prognosis in melanoma. PMID: 26329521
  14. Stuve-Wiedemann syndrome patients with (p.Arg692X) LIFR mutation may develop central adrenal insufficiency due to impaired LIF/LIFR signalling. LIF/LIFR system plays a role in human HPA axis regulation. PMID: 25145448
  15. these findings conclude that LIFR functions as a novel metastasis suppressor in Hepatocellular carcinoma and may serve as a prognostic biomarker for Hepatocellular carcinoma patients. PMID: 26249360
  16. LIFR may play a functional role in hepatocarcinogenesis PMID: 25749520
  17. Expression of the LIF receptor was strongly increased on immune cells of multiple sclerosis patients. PMID: 25514345
  18. The LIFRalpha-CT3 TAT fusion protein can inhibit miR-155 expression PMID: 25092123
  19. LIFR signaling usually follows the JAK/STAT3 pathway, and is initiated by several interleukin-6-type cytokines PMID: 24618404
  20. R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR. PMID: 24802752
  21. LIFR rs3729740 and possibly ANXA11 rs1049550 may be useful as biomarkers for predicting whether metastatic colorectal cancer patients are sensitive to relevant target regimens, although further validation in large cohorts is needed. PMID: 23579219
  22. Because acute ventricle enlargement is observed in susceptible CD118-deficient mice, the phenomenon may occur in a subpopulation of human adults with herpes simplex encephalitis. PMID: 23382563
  23. findings show that LIFR is a key novel tumor suppressor, whose deregulation may drive the transformation of a significant proportion of human breast cancers PMID: 22535017
  24. findings identify LIFR as a metastasis suppressor that functions through the Hippo-YAP pathway and has significant prognostic power. PMID: 23001183
  25. A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID: 22829597
  26. A significant association was detected between the LIFR gene polymorphisms and schizophrenia patients with persecutory delusion PMID: 21971603
  27. LIF and LIFR immunolocalized to decidual cells in the mid-late secretory phase endometrium and 1st trimester decidua. PMID: 21966484
  28. These results demonstrate that cancer-specific methylation and a specific decrease of LIFR expression are a common inactivation event in colon cancer development. PMID: 21617854
  29. Down regulation of Leukemia inhibitory factor receptor is associated with hepatocellular carcinoma. PMID: 19733004
  30. The present study indicated that the LIF gene variant may produce susceptibility to hebephrenic schizophrenia and deterioration of working memory function. PMID: 19879916
  31. Review. The structure and function of the LIF-R gene and protein, mRNA processing, and its role in tumor cells are reviewed. PMID: 11042511
  32. upper cytokine-binding module and the Ig-like domain of the leukaemia inhibitory factor (LIF) receptor are sufficient for a functional LIF receptor complex PMID: 11812136
  33. Separate functions for the two modules of the membrane-proximal cytokine binding domain of glycoprotein 190, the leukemia inhibitory factor low affinity receptor, in ligand binding and receptor activation (gp190) PMID: 11834739
  34. interactions of CNTFR with LIFR and gp130 in vitro PMID: 12707266
  35. mutations alter the stability of LIFR messenger RNA transcripts, resulting in the absence of the LIFR protein and in the impairment of the JAK/STAT3 signaling pathway in patient cells PMID: 14740318
  36. immunocytochemical staining and mRNA expression of LIF and its receptor are consistent with the concept that LIF might be involved in growth initiation of human primordial follicles through its receptor PMID: 15044601
  37. In cells overexpressing a LIFR mutant with the N-terminal cytokine binding domain deleted, signaling by ciliary neurotrophic factor was abolished. PMID: 16051226
  38. Expression of leukemia inhibitory factor and its receptor is low in undifferentiated human embryonic stem cells but increases during differentiation. PMID: 16949591
  39. sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties PMID: 17028186
  40. Results present the biophysical and structural characterization of the full-length, transmembrane form of a quaternary cytokine receptor complex consisting of gp130, LIF-R, Ciliary Neurotrophic Factor (CNTF), and its alpha receptor (CNTF-Ralpha). PMID: 18775332

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Cytokines and Growth factors
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TGFB2.
Recombinant Human Transforming Growth Factor Beta-2 (TGFB2) Protein (His)
  • Molecule: TGFB2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Protein Fragment;
CAT#: BLC-11103P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd70 Antigen (CD70) Protein (His)
  • Molecule: CD70;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Extracellular Domain;
CAT#: BLC-10853P

Save $121
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL2.
Recombinant Human Interleukin-2 (IL2) Protein (GST)
  • Molecule: IL2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: GST;
  • Sequence: Full Length Protein;
CAT#: BLC-10775P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Complement C5 (C5) Protein (His)
  • Molecule: C5;
  • Species: Human;
  • Expression system: Mammalian cell;
  • Tag: His;
  • Sequence: Protein Fragment;
CAT#: BLC-09406P

Save $821
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
  • Molecule: CCL18;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08214P

Save $141
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His-SUMO)
  • Molecule: PDGFB;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-07892P

Save $131
Recently viewed