Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His)

Name: Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10932P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Fc receptors, Featured cd protein molecules, Featured fc receptors molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P06734
Target Symbol	FCER2
Synonyms	Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4; C-type lectin domain family 4 member J; C-type lectin domain family 4; member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon receptor II; Fc epsilon RII; Fc fragment of IgE; Fc fragment of IgE low affinity II receptor for; Fc fragment of IgE receptor II; Fc fragment of IgE; low affinity II; receptor for (CD23); Fc of IgE; Fc of IgE; low affinity II; receptor for (CD23); Fc receptor IgE low affinity II alpha polypeptide; Fc receptor; IgE; low affinity II; alpha polypeptide; isoform CRA_a; Fc-epsilon-RII; FCE 2; FCE2; FCER 2; Fcer2; FCER2_HUMAN; FCER2A; FceRII; IgE binding factor; IgE receptor lymphocyte; IgE-binding factor; IGEBF; Immunoglobulin E binding factor; Immunoglobulin E receptor; Immunoglobulin E receptor; low affinity II; Immunoglobulin E-binding factor; Immunoglobulin epsilon chain; LEUKOCYTE ANTIGEN CD23; Low Affinity IgE Receptor; Low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; Ly-42; Ly42; Lymphocyte antigen CD23; Lymphocyte IgE receptor; MGC93219
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	N-6His
Target Protein Sequence	DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Expression Range	48-321aa
Protein Length	Partial
Mol. Weight	33.2 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Subcellular Location	Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor. Secreted. Note=Also exists as a soluble excreted form, sCD23.
Database References	HGNC: 3612 OMIM: 151445 KEGG: hsa:2208 STRING: 9606.ENSP00000264072 UniGene: Hs.465778

Gene Functions References

Report a variant of t(14;18) negative nodal diffuse follicular lymphoma with CD23 expression, 1p36/TNFRSF14 abnormalities, and STAT6 mutations. PMID: 26965583
High CD23 expression is associated with B-cell Lymphoma. PMID: 28108506
found a higher frequency of LIN1(-) CCR3(+) eosinophils, and decreased expression of CD23 and CD62L receptors in eosinophils of AD patients PMID: 27406841
there is a high CD23a/CD23b ratio of chronic lymphocytic leukemia cells, which demonstrates that in a subset of CLL cases, low CD23 expression together with high CD20 and CD38 expressions may serve as a surrogate for trisomy 12 PMID: 26119874
Binding of CTLA4Fcepsilon to FcepsilonRII/CD23 appeared stronger than that of IgE PMID: 26801967
Human and murine P2X7 activation induces the rapid shedding of CD23 from B cells, with a potential role for ADAM10 in this process. PMID: 25155463
Elevated serum sCD23 is associated with increased risk of non-Hodgkin lymphoma. PMID: 25567136
Data suggest that the protective immune response involving CD23-IgE-mediated nitric oxide release in cutaneous leishmaniasis (LCL). PMID: 25802003
Crystal structure of the CD23-Fc3-4 complex with different molecular-packing constraints. PMID: 24598915
data indicate that the studied FCER2 variations are strongly associated with asthma susceptibility and might be risk factor among north Indian asthmatic children PMID: 24102092
we have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay. PMID: 24639354
CD23b-R62W-expressing human B cells bind IgE with greater affinity than wild-type cells and display differences in kinetics of CD23-mediated ERK1/2 activation PMID: 24010859
The interplay of free IgE with IgE-allergen immune complexes of different sizes and composition with CD23 binding represents a mechanism for the modulation of CD23-mediated immune responses. PMID: 23229638
Data indicate that the interaction of IgE with CD23 on B-cells regulates IgE production. PMID: 23933509
Results suggest that binding of Ca(2+) brings an extra degree of modulation to CD23 function. PMID: 23775083
The results are consistent with the suppression of parasite and allergen-specific IgE levels by sCD23. PMID: 23689700
Data indicate that upon sialylation, the affinities for Fcgamma receptors are reduced, whereas those for alternative cellular receptors, such as dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin (DC-SIGN)/CD23, are increased. PMID: 23697368
Results support the complex model of CD23 induction by Epstein-Barr virus (EBV). PMID: 23583387
Downregulation of CD23 attenuated AIMP1-induced TNF-alpha secretion and AIMP1 binding. PMID: 22767513
All subtypes of juvenile arthritis have reduced circulating levels of sCD21 and sCD23. PMID: 21328056
CD23 and FcepsilonRI interaction sites are at opposite ends of the Cepsilon3 domain of IgE, but that receptor binding is mutually inhibitory, mediated by an allosteric mechanism PMID: 22815482
Structural comparisons with both free IgE-Fc and its FcepsilonRI complex reveal not only that the conformational changes in IgE-Fc required for CD23 binding are incompatible with FcepsilonRI binding, but also that the converse is true. PMID: 22802656
Binding of sCD23-derived peptides to av integrins and their biological activities are tolerant of some substitution in the recognition motif. PMID: 22560905
Findings suggest that patients with t(11;14)(+)/CD23(+) plasma cell myelomas (PCM) present with lower platelet counts and may have a shorter overall survival than those with t(11;14)(+)/CD23(-) PCM. PMID: 21724429
Variation at GLCCI1 and FCER2 could lead personalized asthma treatment. PMID: 22304573
Soluble CD23 promoted the release of cytokines from the THP-1 model cell line. In both model cell lines and primary tissue, cytokine release was more pronounced in immature monocyte cells than in mature cells. PMID: 22348662
mIgE & mCD21 cooperate in sCD23-mediated positive regulation of IgE synthesis on committed B cells. Feedback regulation may occur when the secreted-IgE level is big enough to allow binding to mCD23. This prevents further sCD23 release. PMID: 22393152
Transfectants expressing the single nucleotide polymorphism in FCER2 exhibited increased IL-4Ralpha expression after stimulation through CD23 compared with wild-type. PMID: 22059556
Our results suggest that the FCER2 T2206C variant might be a useful pharmacogenetic predictor of steroid refractory patients. PMID: 21958076
SPR analysis revealed a progressive increment in affinity of soluble fragments for IgE, upon increasing length of CD23 "stalk" domain, exCD23>sCD23>derCD23. PMID: 21889131
The association of CD23 and CD30 antigen blood levels with the development of non-Hodgkin lymphoma in HIV patients is reported. PMID: 21860351
Report the role of CD23 SNPs in IgE dependent signaling in B-lymphocytes. PMID: 21686206
IgE may be considered as immune mediator during antiprotozoal activity of human macrophages through its ability to trigger CD23 signaling. PMID: 21526166
show for the first time that CD9 and CD81 act as molecular partners of trimeric FcvarepsilonRI on human antigen-presenting cell PMID: 21241315
CD23 and CD19 are important factors that associated with serum total IgE in the pathogenesis of allergic rhinitis. PMID: 20359104
CD23-mediated immunoglobulin (Ig)E transcytosis in human airway epithelial cells may play a critical role in initiating and contributing to the perpetuation of airway allergic inflammation. PMID: 21307287
A model of CD23-bound IgE-mediated amplification of immunity by B cells is demonstrated in schistosomiasis. PMID: 21160045
Data suggest that the CD23-mediated signal transduction pathways in human B cells and human monocytes are different. PMID: 20805040
Data indicate that the regions of CD23 responsible for interaction with ligands have been identified and help to explain the structure-function relationships within the CD23 protein. PMID: 20831712
CD23 is a useful marker in distinguishing mediastinal diffuse large B-cell lymphoma and classical Hodgkin lymphoma in mediastinal biopsies. PMID: 19223373
Interaction of functional FCER2 promoter polymorphism and phenotype-associated haplotypes PMID: 19845913
cd23 negativity is rare in typical b-cell CLL; negativity in patients with CD19+/CD5+ is suggestive of mantle cell leukemia PMID: 11920534
prognostic significance of soluble CD23 in advanced stages of B-chronic lymphocytic leukemia and its role as an indicator for aggressive or indolent courses of disease. PMID: 12002758
a review on the domains and functions of the cd23 receptor PMID: 12022472
upstream regions of the CD23a and CD23b isoform coding sequences show distinct sensitivities to agents which induce CD23 protein expression at the plasma membrane PMID: 12070780
Investigation of several stimulators to promote CD23a expression on CLL vs. normal B-cells confirmed a different CD23 regulation in B-CLL. CD23a is always predominantly expressed (constant ratio of CD23a:CD23b). PMID: 12127553
CD23 expression in chronic lymphocytic leukemia was 53.9 times higher than in mantle-cell llymphoma. PMID: 12127555
At term, the percentage of CD21(+) and CD23(+) B cells was comparable to the adult PMID: 12149502
promoter is a target for NF-AT transcription factors in B-CLL cells PMID: 12379312
The data show that monocyte-derived DC express the P2X7 receptor whose activation opens a cation-selective channel, and which leads to rapid and near complete shedding of CD23. PMID: 12456589

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.