Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii-B (FCGR3B) Protein (His-GST&Myc)

Name: Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii-B (FCGR3B) Protein (His-GST&Myc)
Brand: Beta LifeScience
SKU: BLC-07484P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: Cluster of differentiation (cd) proteins, Fc receptors, Featured cd protein molecules, Featured fc receptors molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii-B (FCGR3B) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O75015
Target Symbol	FCGR3B
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-GST&C-Myc
Target Protein Sequence	MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH
Expression Range	18-125aa
Protein Length	Partial
Mol. Weight	47.5 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Secreted after cleavage.
Database References	HGNC: 3620 OMIM: 610665 KEGG: hsa:2215 STRING: 9606.ENSP00000294800 UniGene: Hs.372679
Tissue Specificity	Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.

Gene Functions References

SHP-2 is activated by CD16b crosslinking in neutrophils. PMID: 29137913
FCGR3B deficiency due to copy number variations may predispose to eosinophilic granulomatosis with polyangiitis. PMID: 26684293
The FCGR3B NA1/NA1 genotype is associated with hypersensitivity reactions to adalimumab in Japanese patients with Rheumatoid Arthritis. PMID: 27830964
Data suggest association of FCGR3B deletion with increased risk of rheumatoid arthritis (RA) in a large cohort. PMID: 27995740
Association between Fc gamma Receptor IIIB genetic polymorphisms and susceptibility to severe malaria anemia in children in western Kenya. PMID: 28427365
CD16 and CD35 are important for neutrophil internalization of M. tuberculosis, whereas HIV-1 infection adversely affects opsonophagocytosis. PMID: 27258232
There was no aberration in FCGR3B allele/genotype frequencies in sarcoidosis patients compared to controls. PMID: 26801149
Results showed that susceptibility to systemic lupus erythematosus was associated with the FCGR3B*01 allele, as well as with the FCGR3B*01/*01 and FCGR3B*01/*02 genotypes. PMID: 26946294
FcgammaRIIIB allelic distribution was similar among pediatric Guillain-Barre syndrome patients and controls. PMID: 27064330
data show that cross-linking FcgammaRIIIb is responsible for NET formation by the human neutrophil PMID: 27034964
the results of this meta-analysis indicated that low FCGR3B CN increased susceptibility to autoimmune diseases--{REVIEW} PMID: 26407570
FCGR3B copy number related to systemic lupus and lupus nephritis susceptibility. PMID: 24673810
No relationship was found between the FCGR3B polymorphism and rheumatoid arthritis susceptibility. PMID: 26314337
This study compared the FCGR3B gene frequencies among 230 unrelated healthy Eastern Thai blood donors in Rayong hospital with the previously published studies. PMID: 25626603
FcgammaRIIIb polymorphism is not associated with susceptibility to systemic lupus erythematosus in Brazilian patients PMID: 24896836
in the Indian population, FCGR3B gene copy number varied significantly when compared to other populations of the world. PMID: 25428402
A high copy number of FCGR3B is associated with psoriasis vulgaris in Han Chinese. PMID: 25012234
This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag. PMID: 25024378
The frequencies of FCGR3B*1, FCGR3B*2, and FCGR3B*3 alleles in central Thai blood donors were 0.548, 0.452, and 0.004. PMID: 24205492
Copy number of polymorphisms in FCGR3B gene is associated with ulcerative colitis. PMID: 23917248
The absolute risk of malaria decreased more rapidly with increasing antibody levels for Fc gamma receptor 3B 233AA/AC individuals compared with 233CC children. PMID: 23935200
The FCGR3B NA1/NA2 polymorphism may be associated with susceptibility to aggressive periodontitis. PMID: 23649770
study concludes gene copy number of FcgammaR2C and FcgammaR3B influences IVIG treatment response and predisposes individuals to Kawasaki disease, providing potential insights into understanding the mechanism of the FcgammaR gene family in the IVIG pathway PMID: 23778324
Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b. PMID: 23398146
Higher CD16+ cytotoxic NK+T lymphocyte levels predict superior survival outcomes in patients with metastatic carcinoma. PMID: 23281059
Low copy number of the Fc-gamma receptor 3B gene FCGR3B is a risk factor for primary Sjogren's syndrome. PMID: 22942264
Studies indicate beta-defensins (DEFB4, DEFB103, DEFB104), chemokine ligand 3 like 1 (CCL3L1), Fc gamma receptor 3B (FCGR3B), and complement component C4 (C4) for copy number variation in disease association. PMID: 22837109
The FcgammaRIIIB-SH allotype (CTGAAA) containing the 233A-allele (in bold) was associated with protection from malaria. The FcgammaRIIIB-NA2*03 allotype (CTGCGA), a variant of the classical FcgammaRIIIB-NA2 (CTGCAA) was associated with susceptibility to malaria. PMID: 23049979
suggest that impaired immune complex clearance arising from FCGR3B deficiency contributes to the pathology of systemic sclerosis, and FCGR3B copy number variation is a common risk factor for systemic autoimmunity PMID: 22551723
CD14++CD16+ monocytes independently predicted cardiovascular events in subjects referred for elective coronary angiography. PMID: 22999728
Study indicates that a low copy number of the FCGR3B gene is associated with susceptibility to rheumatoid arthritis (RA). PMID: 22309893
The FcgammaRIIIB-NA1 variant, which confers higher affinity for IgG than the NA2 variant, is a determining factor for treatment response. PMID: 22565545
FCGR3B*1, FCGR3B*2 and FCGR3B*3 allele frequencies were respectively 0.347, 0.573 and 0.080 among Tunisians of sub-Saharan origin, 0.379, 0.591 and 0.030 among Tunisian blood donors and 0.318, 0.546 and 0.136 among the group from sub-Saharan Africa. PMID: 22512913
Both ADAM10 and ADAM17 could shed CD16b, but they possess differed preferences. ADAM10 is the main sheddase under stimulation of ionomycin, while ADAM17 is the main sheddase under stimulation of PMA. PMID: 22770404
NA2/NA2 and/or NA2 allele may be risk factors for generalized aggressive periodontitis in the population of South India PMID: 22167032
In this Brazilian FCGR3B*03(+) group we found that the inheritance of FCGR3B*03 took place by a linkage to FCGR3B*02 or to FCGR3B*01. PMID: 21895673
FCGR3B DNA copy number variation is associated with systemic lupus erythematosus risk in afro-caribbeans. PMID: 21296850
Monocyte subsets have specialized roles during inflammation: CD16-positive monocytes might undergo an immediate innate immune response, whereas CD16-negative monocytes could have a major role as antigen presenting cells. PMID: 21937707
Our results suggest that FcgammaRIIIb might not be a susceptibility gene for SLE and lupus nephritis. PMID: 20300756
copy number associated with susceptibility to idiopathic pulmonary fibrosis PMID: 21109729
IL-21 stimulates the production of IL-10 by CD4(+) T-cells. Secreted Il-10 maintains the expression of CD16 on monocytes. PMID: 21227406
the neutrophil responses to stimuli that engage FcGR3B and FcGR2A, namely the phagocytosis of human IgG-opsonized zymosan and the responses to heat-aggregated IgGs PMID: 21123174
FcgammaRIIIb NA1/2 polymorphisms are associated with idiopathic pulmonary fibrosis disease susceptibility but not with disease progression. PMID: 20924590
study highlights the complexity and poor characterization of the FCGR3B gene sequence, indicating that the design and interpretation of genotyping assays based on specific probe sequences must be performed with caution PMID: 20957197
The FCGR3B NA1/NA1 genotype was found in 75% of the patients with infusion reactions and in only 37% of those without (p=0.01), whereas the FCGR3A 176F/V genotype was equally distributed in the patients with or without infusion reactions. PMID: 20980704
FcgammRIIA and FcgammaRIIIB are required for neutrophil mediated dermal epidermal separation in bullous pemphigoid PMID: 20720565
results, obtained by fitting logistic regression models, confirm the association of low copy number of FCGR3B with systemic lupus erythematosus PMID: 20442749
Results of the present study suggest that subjects carrying at least one copy of the FcgammaRIIIb-NA2 allele might be associated with susceptibility to aggressive periodontitis. PMID: 20041976
The primary involvement of Fc gamma R IIIB NA2 allele is more likely involved with disease susceptibility of systemic lupus erythematosus. PMID: 20536598
Significant evidence for an association between copy number and rheumatoid arthritis was observed in the Dutch cohort but not in the two smaller cohorts (New Zealand and United Kingdom populations, respectively). PMID: 20472591

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.