Recombinant Human MIF Protein
Beta LifeScience
SKU/CAT #: BLA-1675P
Recombinant Human MIF Protein
Beta LifeScience
SKU/CAT #: BLA-1675P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | GIF GLIF Glycosylation inhibiting factor Glycosylation-inhibiting factor L-dopachrome isomerase L-dopachrome tautomerase Macrophage migration inhibitory factor Macrophage migration inhibitory factor (glycosylation-inhibiting factor) MIF MIF protein MIF_HUMAN MMIF Phenylpyruvate tautomerase |
Description | Recombinant Human MIF Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAF GGSSEPALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINY YDMNAANVGWNNSTF- ALEHHHHHH |
Molecular Weight | 14 kDa |
Purity | >95% SDS-PAGE.Purified to apparent homogeneity by using conventional column chromatography techniques.Purity greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |