Recombinant Human Neuritin (NRN1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04328P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Neuritin (NRN1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04328P
Collections: Cytokines, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Neuritin (NRN1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9NPD7 |
Target Symbol | NRN1 |
Synonyms | Neuritin 1; Neuritin; NRN; Nrn1; NRN1_HUMAN; OTTHUMP00000015989; RP3 380B8.2 protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG |
Expression Range | 28-116aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 25.8kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Cell junction, synapse. |
Protein Families | Neuritin family |
Database References |
Gene Functions References
- NRN1 is expressed more extensively in melanoma than in normal melanocytes and healthy tissue. Secreted NRN1 seems to play a role also in earlier phases of melanoma development as we can discover NRN1 over-expression to be associated to primary melanoma PMID: 27901477
- results suggest that DTNBP1 and NRN1 genes show a joint effect on the risk for schizophrenia spectrum disorders. Although the precise mechanism underlying this effect is unclear, the fact that these genes have been involved in synaptic maturation, connectivity and glutamate signalling suggests that our findings could be of value as a link to the schizophrenia aetiology. PMID: 27855309
- NRN1 is associated with depressive symptoms and executive function in a non-clinical sample. Our results also suggest that the role of NRN1 seems to be modulated by BDNF. PMID: 28107668
- On analysis of the expression of NRN1 in SMA patients for the first time, NRN1 could be a potential modifier gene PMID: 27279027
- Ca(2+)/calcineurin (CaN)/nuclear factor of activated T-cells (NFAT) c4 axis is required for neuritin-induced Kv4.2 transcriptional expression and potentiation of IA densities in cerebellum granule neurons. PMID: 27307045
- (i) NRN1 variability is a shared risk factor for both schizophrenia-spectrum disorders (SSD) and bipolar disorders (BPD), (ii) NRN1 may have a selective impact on age at onset and intelligence in SSD. PMID: 26700405
- Data indicate that neuritin not only plays an important role in the nervous system but also has an effect on the migration, senescence, proliferation, and viability of stem cells PMID: 26208391
- Neuritin is reduced in the brains of Alzheimer's disease (AD) patients. PMID: 25101829
- MiR-204 promotes apoptosis in oxidative stress-induced rat Schwann cells by suppressing neuritin expression PMID: 25036738
- we found neuritin is overexpressed in astrocytoma, which may be an important factor in tumorigenesis and progression of astrocytoma PMID: 20405246
- Data show that SMN and HuD form a complex in spinal motor axons, and that both interact with cpg15 mRNA in neurons. PMID: 21652774
- NRN1 polymorphisms have roles in fluid intelligence in schizophrenia PMID: 19569075
- CPG15 and CPG15-2 perform similar cellular functions but may play distinct roles in vivo through their cell-type- and tissue-specific transcriptional regulation PMID: 18265009