Recombinant Human Noggin Protein
Beta LifeScience
SKU/CAT #: BLA-1683P
Recombinant Human Noggin Protein
Beta LifeScience
SKU/CAT #: BLA-1683P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | Nog NOGG_HUMAN Noggin SYM 1 SYM1 Symphalangism 1 (proximal) Synostoses (multiple) syndrome 1 SYNS 1 SYNS1 |
Description | Recombinant Human Noggin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDP GFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLE FSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRY VKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQ YPIISECKCSC |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |