Recombinant Human P-Selectin (SELP) Protein (hFc-Myc)
Beta LifeScience
SKU/CAT #: BLC-07632P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human P-Selectin (SELP) Protein (hFc-Myc)
Beta LifeScience
SKU/CAT #: BLC-07632P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human P-Selectin (SELP) Protein (hFc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P16109 |
Target Symbol | SELP |
Synonyms | CD62 antigen-like family member P;Granule membrane protein 140;GMP-140;Leukocyte-endothelial cell adhesion molecule 3;LECAM3;Platelet activation dependent granule-external membrane protein;PADGEM;CD62P |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc-Myc |
Target Protein Sequence | WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA |
Expression Range | 42-771aa |
Protein Length | Partial |
Mol. Weight | 108.8 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with SELPLG. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | Selectin/LECAM family |
Database References | |
Associated Diseases | Ischemic stroke (ISCHSTR) |
Tissue Specificity | Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface. |
Gene Functions References
- Suggest role for soluble P-selectin in the diagnosis of venous thromboembolism. PMID: 30093507
- plasma level predictive of high residual platelet reactivity during maintenance-phase dual antiplatelet therapy PMID: 29334682
- Kidney transplant has a significant restorative effect on platelet aggregation and coagulation functions independent of platelet activation, as evaluated with P-selectin levels. PMID: 27267514
- In Chinese Han population cardiovascular disease (CVD) risk is significantly higher in carriers with rs1800805-A allele (GA and AA) in the selectin P gene (SELP) than those with GG genotype. CVD risk is the highest for rs1800805-GA or AA carriers with additional genetic polymorphisms 1800796-GC or CC in interleukin 6 gene. PMID: 28819827
- VWF, GMP-140, ADAMTS13 and the cerebral vasospasm, delayed cerebral ischemia, tumor diameter and prognosis of aneurysmal subarachnoid hemorrhage patients are closely related PMID: 29077161
- The highest level of sP-selectin in colorectal patients was observed in patients with metastases to the liver (stage IV), and was significantly higher than in patients without metastases (stage I/II) and with lymph node metastases (stage III), p = .02. P-selectin plays an important role in the progression of CRC PMID: 27775438
- Serum P-selectin levels are not altered in cystic fibrosis patients. PMID: 28646244
- miR-223, miR-26b, miR-126 and miR-140 are expressed at a lower level in platelets and megakaryocytes in type 2 diabetics causing up-regulation of P2RY12 and SELP mRNAs that may contribute to adverse platelet function. PMID: 27975100
- coronary thrombi in STEMI patients resistant to fibrinolysis are characterised by higher fibrin, P-selectin and VWF content than lysis-sensitive thrombi PMID: 26962963
- P-Selectin and ICAM-1 have roles in mediating THP-1 monocyte adhesion PMID: 28262902
- Transgenic expression of SELP is atherogenic in Apoe(-/-) mice, suggesting that P-selectin contributes to atherogenesis. PMID: 27102967
- These results provide a novel insight into the mechano-chemical regulation mechanism for P-selectin-induced calcium signaling of neutrophils in flow. PMID: 28097631
- Data indicate no association of maternal or fetal ITGA2 C807T SNP, ITGB3 T1565C SNP, PECAM1 CTG - GTG and SELP A/C polymorphisms with fetal growth restriction (FGR). PMID: 28358707
- Study concluded that the genotype and allele frequencies of SELP S290N were not significant different between the acute ischemic stroke case group and the control group as well as between each subtype group and the control group PMID: 27423570
- High SELP expression is associated with Inflamed Atherosclerotic Plaque. PMID: 27237221
- Circulating P-selectin levels were closely associated with endocan levels in obese children and adolescents with non-alcoholic fatty liver disease. PMID: 28318371
- Primary Aldosteronism is related to platelet activation, expressed as higher plasma values of soluble CD40L and soluble P-selectin values. PMID: 27101095
- Immobilized P-selectin-induced calcium signaling of HL-60 cells is P-selectin concentration- and mechanical force-dependent PMID: 28155729
- results found that LMWF protected the renal function in diabetic nephropathy rats and alleviated inflammation through the modulation of P-selectin and inflammatory cytokines. LMWF may have therapeutic potential against diabetic nephropathy. PMID: 27234491
- The study establishes that thrombotic-inflammatory pathways enhancing P-selectin exposure unrelated to treatment might be activated in patients, while the event rate remained lowered, and hence, treatment strategies should be inclusive to control these factors. PMID: 27406211
- This study could not support the potential benefit of the high-dose vitamin D on plasma level of P-selectin and hs-CRP in patients with VTE. PMID: 25601896
- The level of d-dimer, P-selectin, and platelet count might be good candidate predictive markers for PVT in patients with cirrhotic PHT after devascularization. The combined test of the 3 markers can increase the value of prediction. PMID: 25633343
- deletion of P-sel disrupted megakaryocyte/neutrophil interactions in spleen, reduced TGF-beta content, and corrected the hematopoietic stem cells distribution that in Gata1(low) mice, as in primary myelofibrosis patients, is abnormally expanded in spleen. PMID: 26439305
- Elevated plasma P-selectin autoantibodies may play a role in the pathogenesis of thrombocytopenia in pSS patients. PMID: 26613867
- The addition of sialic acid enhances the affinity of CD15 to P-selectin and augments the cell adhesion to blood vessel endothelial cells. PMID: 26418972
- This study provides a better understanding of the biology of P-selectin and PSGL-1 and their roles in dissemination and resensitization of Multiple myeloma treatment. PMID: 26539491
- Data (including data from studies in transgenic mice) suggest that sequence variations limited to 1.4-kb proximal promoter region account for most differences in expression of murine Selp and human SELP genes. PMID: 26631722
- P-selectin gene polymorphisms and haplotypes can contribute to proliferative diabetic retinopathy development. PMID: 26344728
- P-selectin polymorphism of -825T/C is associated with the risk of pulmonary hypertension in congenital heart defects, and may be one of its risk factors. PMID: 26261613
- Soluble P-selectin was upregulated I ankylosing spondylitis patients could predict prognosis. PMID: 26261626
- P-selectin has a role in endothelial progenitor cells' inhibition of platelet function PMID: 25948279
- s. Leukocyte filtration does not affect the CD62P surface expression of apheresis platelets stored for up to 2 days, which indicates that leukocyte filtration does not damage the activation of apheresis platelets within the retention period PMID: 26125797
- Plasmodium falciparum MSP7 and P-selectin were shown to bind each other directly via the N-terminus of PfMSP7 and the P-selectin C-type lectin and EGF-like domains. PMID: 26045295
- CD62P levels may be useful as a sensitive clinical marker for the early detection of DWMLs [deep white matter lesions]with cognitive decline. PMID: 26388436
- time changes of sCD40L over 1 month after myocardial infarct onset were associated with G894T eNOS polymorphism and with the VEGF concentrations, but not to the platelet CD62P expression PMID: 26279254
- Platelet-bound P-selectin appears to be the major determinant of leukocyte-platelet interactions in patients with cardiovascular disease. PMID: 25428141
- Inclacumab was well tolerated by the majority of subjects after single intravenous infusion and demonstrated pharmacological activity against both cell expressed P-selectin and soluble P-selectin. PMID: 25714598
- There was a larger number of endothelial cells expressing SELP in the lepromatous form compared to the tuberculoid form of leprosy skin lesions. PMID: 26051909
- The adhesion molecules CD62P and CD44 play an important role in the pathogenesis of bronchiolitis. PMID: 26575878
- SELp expression on platelets of type 2 diabetes patients without prior ischemic events was similar to that of controls. PMID: 26068309
- Observe ethnic heterogeneity in the association of P-selectin and risk of coronary heart disease. PMID: 25744700
- P-selectin is significantly associated with the development of peripheral artery disease PMID: 25682040
- SELP polymorphisms are associated with cachexia development in pancreatic cancer patients. PMID: 25238546
- Data indicate that the simultaneous assay of activated platelets (aPLTs) and platelet-activating capacity by P-selectin (CD62P) detection using whole blood treated with the K2-EDTA anticoagulant was useful for the monitoring of antiplatelet drugs. PMID: 22862794
- Diesel exhaust exposure during exercise induces platelet activation as illustrated by a dose-response increase in the release of CD62P and CD63. PMID: 25297946
- Soluble P-selectin promotes acute myocardial infarction onset but not severity. PMID: 25384966
- P-selectin may not be a predicted risk factor for deep vein thrombosis after total hip arthroplasty PMID: 25057500
- Minor allele homozygotes for the variant rs6128 were less likely to develop diabetic retinopathy PMID: 25794792
- expression of P-selectin and P-selectin glycoprotein ligand-1, forming an auto-augmented loop of porcine aortic endothelial cells and platelet activation PMID: 25405250
- von Willebrand factor and IL-6, but not P-selectin in the peripheral and cardiac radiofrequency catheter ablation of atrial fibrillation circulation are affected by PMID: 25390649