Recombinant Human PDGF AB Protein (Animal Free)

Name: Recombinant Human PDGF AB Protein (Animal Free)
Brand: Beta LifeScience
SKU: BLA-1727P
Availability: InStock

Collections: Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Synonym	becaplermin c-sis GDGF ODGF Oncogene SIS PDGF A chain PDGF B chain PDGF subunit A PDGF subunit B PDGF1 PDGF2 PDGFA PDGFB Platelet derived growth factor 2 Platelet derived growth factor A chain Platelet derived growth factor alpha chain Platelet derived growth factor alpha polypeptide Platelet derived growth factor subunit A platelet-derived growth factor 2 platelet-derived growth factor A chain platelet-derived growth factor alpha chain platelet-derived growth factor alpha isoform 2 preproprotein platelet-derived growth factor alpha polypeptide platelet-derived growth factor B chain platelet-derived growth factor beta polypeptide platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) platelet-derived growth factor subunit A platelet-derived growth factor subunit B platelet-derived growth factor, beta polypeptide (oncogene SIS) proto-oncogene c-Sis Simian sarcoma viral oncogene homolog SIS SSV V-SIS platelet-derived growth factor beta polypeptide
Description	Recombinant Human PDGF AB Protein (Animal Free) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	Alpha chain:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVK RCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLEC ACATTSLNPDYREEDTGRPRESGKKRKRKRLKPTBeta chain:SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPP CVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLG DHLACKCETVAAARPVT
Molecular Weight	26 kDa
Purity	>95% SDS-PAGE.Purity determined by Reducing and Non-reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	The activity is determined by the dose-dependent proliferation of mouse 3T3 indicator cells and is typically less than 1 ng/mL.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.