Recombinant Human PDGF B Protein
Beta LifeScience
SKU/CAT #: BLA-1732P
Recombinant Human PDGF B Protein
Beta LifeScience
SKU/CAT #: BLA-1732P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P01127-2 |
Synonym | Becaplermin c sis FLJ12858 Oncogene SIS PDGF 2 PDGF B chain PDGF Beta PDGF subunit B PDGF-2 PDGF2 Pdgfb PDGFB_HUMAN Platelet derived growth factor 2 Platelet derived growth factor B chain Platelet derived growth factor beta Platelet derived growth factor beta polypeptide Platelet derived growth factor beta polypeptide (oncogene SIS) Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog) Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Platelet-derived growth factor subunit B Proto-oncogene c-Sis Simian sarcoma viral (v sis) oncogene homolog SIS SSV v sis platelet derived growth factor beta polypeptide |
Description | Recombinant Human PDGF B Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMCKTRTEVFEISRRLIDRTNANFLVWPPCV EVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDH LACKCETVAAARPVTRSPGGSQEQRAKTPQ |
Molecular Weight | 15 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |