Recombinant Human PDGFC Protein
Beta LifeScience
SKU/CAT #: BLA-1740P
Recombinant Human PDGFC Protein
Beta LifeScience
SKU/CAT #: BLA-1740P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9NRA1 |
Synonym | Fallotein hSCDGF PDGF-C PDGFC PDGFC latent form PDGFC receptor-binding form PDGFC_HUMAN Platelet derived growth factor C Platelet-derived growth factor C, receptor-binding form SCDGF Secretory growth factor like protein Secretory growth factor like protein fallotein Spinal cord derived growth factor Spinal cord-derived growth factor VEGF E VEGF-E |
Description | Recombinant Human PDGFC Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERII TVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPE DDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYF PSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLI RYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSC TPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG |
Molecular Weight | 65 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |