Recombinant Human Placental lactogen Protein
Beta LifeScience
SKU/CAT #: BLA-1754P
Recombinant Human Placental lactogen Protein
Beta LifeScience
SKU/CAT #: BLA-1754P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P01243 |
Synonym | Choriomammotropin Chorionic somatomammotropin A chorionic somatomammotropin B Chorionic somatomammotropin hormone Chorionic somatomammotropin hormone 1 chorionic somatomammotropin hormone 1 (placental lactogen) chorionic somatomammotropin hormone 2 CS 2 CS-2 CS1 CSA CSB CSH_HUMAN CSH1 CSH2 CSMT hCS B hCS-B hCSA Lactogen mPL II PL PL1 Placental lactogen Prl3b1 prolactin family 3, subfamily b, member 1 |
Description | Recombinant Human Placental lactogen Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQT SFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANN LVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNS HNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFVDHHHHHH |
Molecular Weight | 23 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |