Recombinant Human Plasma Kallikrein (KLKB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10756P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Plasma Kallikrein (KLKB1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10756P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Plasma Kallikrein (KLKB1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P03952 |
Target Symbol | KLKB1 |
Synonyms | Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B; plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR |
Expression Range | 20-390aa |
Protein Length | Partial |
Mol. Weight | 43.4kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S1 family, Plasma kallikrein subfamily |
Database References | |
Associated Diseases | Prekallikrein deficiency (PKK deficiency) |
Gene Functions References
- We further define the interactions of keratinocyte PKK with TP63 and NF-kappaB signaling, highlighting the importance of this protein as a tumor suppressor in skin squamous cell carcinoma development. PMID: 29186361
- Plasma kallikrein (PLK)-dependent transforming growth factor-beta (TGF-beta) activation could be detected in isolated pancreatic stellate cells (PSCs) from chronic pancreatitis (CP) and pancreatic cancer. PMID: 28187111
- High molecular weight kinin functions as a cofactor for PK activation in the presence of nucleic acids in a manner consistent with classic models of contact activation. PMID: 28124063
- genetic polymorphism is associated with C1 Inhibitor deficiency angioedema age of onset in European families PMID: 29130992
- these data indicate that KLKB1 induces inflammatory reactions in human dental tissues via protease-activated receptor 1 PMID: 26566265
- von Willebrand factor activity and concentration of prekallikrein may both be of importance regarding the evolution of thrombus in abdominal aortic aneurysm and possible biomarkers for aneurysm growth. PMID: 27581227
- KLKB1 mRNA expression is a putative molecular biomarker in chronic lymphocytic leukemia. PMID: 25891023
- Genotyping these subjects revealed that the carriers of the minor alleles at the two loci- F12 and KLKB1 had a significant association with reduced levels of active plasma renin. PMID: 26969407
- 2 genetic loci (kininogen 1 and kallikrein B) influencing key components of the RAAS, consistent with the close interrelation between the kallikrein-kinin system and the RAAS. PMID: 25477429
- PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation. PMID: 25324000
- Prekallikrein deficiency in a family is due to a new mutation (Arg541Gln) in exon 14. PMID: 25075649
- FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either PMID: 24977287
- The acquisition of an active site in prekallikrein as a result of binding to high-molecular-weight kininogen (HK) is a new concept for bradykinin formation and might be relevant in the pathogenesis of hereditary angiodema types I and II. PMID: 23672780
- Investigate the relationship between circulating PK levels in children with metabolic syndrome and CVD risk factors because PK may be involved in the progression of the disease state. PMID: 20725119
- Case Report: Fresh frozen plasma transfusion before coronary artery bypass corrects prekallikrein deficiency. PMID: 20135073
- plasma kallikrein and FXIa activate pro-HGF in vitro PMID: 12372819
- the effect of kininogen degradation by human neutrophil elastase (HNE) on kinin generation by tissue and plasma kallikreins. PMID: 12887060
- prekallikrein preferential binding to endothelial cells contributes to their anticoagulant nature PMID: 12944405
- Crystallization and x-ray crystal structure determination have yielded the first three-dimensional views of the catalytic domain of plasma kallikrein PMID: 16199530
- Our findings suggested that common genetic variation in the KLKB1 gene might contribute to the risk of hypertension in the northern Han Chinese population. PMID: 17318641
- study demonstrates by immunohistochemistry that plasma kallikrein (PK) is localised in cells of different embryologically derived human tissues PMID: 17696780
- three-dimensional structural data for prekallikrein (PK); interaction between PK and high-molecular-weight kininogen is mediated by two discrete surfaces formed by the PK A1, A2 and A4 domains with charge likely to be a critical component of the binding PMID: 17922805
- Kallikrein can directly activate prothrombin; there is a shortcut in the intrinsic hemostasis system that generates catalytic amounts of thrombin without following the known intrinsic clotting pathway PMID: 18160576
- Kallikrein is responsible for the cleavage of factor H. PMID: 18413232
- prekallikrein is an enzyme that can cleave high-molecular-weight kininogen to release bradykinin, and this reaction is inhibited by C1 inhibitor. PMID: 19342086
- NPY3-35 is a new peptide generated by plasma kallikrein PMID: 19620246