Recombinant Human Plasma Kallikrein (KLKB1) Protein (His)

Name: Recombinant Human Plasma Kallikrein (KLKB1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10756P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Cytokines, Cytokines and growth factors, Growth factors and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Plasma Kallikrein (KLKB1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P03952
Target Symbol	KLKB1
Synonyms	Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B; plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
Expression Range	20-390aa
Protein Length	Partial
Mol. Weight	43.4kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Subcellular Location	Secreted.
Protein Families	Peptidase S1 family, Plasma kallikrein subfamily
Database References	HGNC: 6371 OMIM: 229000 KEGG: hsa:3818 STRING: 9606.ENSP00000264690 UniGene: Hs.237642
Associated Diseases	Prekallikrein deficiency (PKK deficiency)

Gene Functions References

We further define the interactions of keratinocyte PKK with TP63 and NF-kappaB signaling, highlighting the importance of this protein as a tumor suppressor in skin squamous cell carcinoma development. PMID: 29186361
Plasma kallikrein (PLK)-dependent transforming growth factor-beta (TGF-beta) activation could be detected in isolated pancreatic stellate cells (PSCs) from chronic pancreatitis (CP) and pancreatic cancer. PMID: 28187111
High molecular weight kinin functions as a cofactor for PK activation in the presence of nucleic acids in a manner consistent with classic models of contact activation. PMID: 28124063
genetic polymorphism is associated with C1 Inhibitor deficiency angioedema age of onset in European families PMID: 29130992
these data indicate that KLKB1 induces inflammatory reactions in human dental tissues via protease-activated receptor 1 PMID: 26566265
von Willebrand factor activity and concentration of prekallikrein may both be of importance regarding the evolution of thrombus in abdominal aortic aneurysm and possible biomarkers for aneurysm growth. PMID: 27581227
KLKB1 mRNA expression is a putative molecular biomarker in chronic lymphocytic leukemia. PMID: 25891023
Genotyping these subjects revealed that the carriers of the minor alleles at the two loci- F12 and KLKB1 had a significant association with reduced levels of active plasma renin. PMID: 26969407
2 genetic loci (kininogen 1 and kallikrein B) influencing key components of the RAAS, consistent with the close interrelation between the kallikrein-kinin system and the RAAS. PMID: 25477429
PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation. PMID: 25324000
Prekallikrein deficiency in a family is due to a new mutation (Arg541Gln) in exon 14. PMID: 25075649
FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either PMID: 24977287
The acquisition of an active site in prekallikrein as a result of binding to high-molecular-weight kininogen (HK) is a new concept for bradykinin formation and might be relevant in the pathogenesis of hereditary angiodema types I and II. PMID: 23672780
Investigate the relationship between circulating PK levels in children with metabolic syndrome and CVD risk factors because PK may be involved in the progression of the disease state. PMID: 20725119
Case Report: Fresh frozen plasma transfusion before coronary artery bypass corrects prekallikrein deficiency. PMID: 20135073
plasma kallikrein and FXIa activate pro-HGF in vitro PMID: 12372819
the effect of kininogen degradation by human neutrophil elastase (HNE) on kinin generation by tissue and plasma kallikreins. PMID: 12887060
prekallikrein preferential binding to endothelial cells contributes to their anticoagulant nature PMID: 12944405
Crystallization and x-ray crystal structure determination have yielded the first three-dimensional views of the catalytic domain of plasma kallikrein PMID: 16199530
Our findings suggested that common genetic variation in the KLKB1 gene might contribute to the risk of hypertension in the northern Han Chinese population. PMID: 17318641
study demonstrates by immunohistochemistry that plasma kallikrein (PK) is localised in cells of different embryologically derived human tissues PMID: 17696780
three-dimensional structural data for prekallikrein (PK); interaction between PK and high-molecular-weight kininogen is mediated by two discrete surfaces formed by the PK A1, A2 and A4 domains with charge likely to be a critical component of the binding PMID: 17922805
Kallikrein can directly activate prothrombin; there is a shortcut in the intrinsic hemostasis system that generates catalytic amounts of thrombin without following the known intrinsic clotting pathway PMID: 18160576
Kallikrein is responsible for the cleavage of factor H. PMID: 18413232
prekallikrein is an enzyme that can cleave high-molecular-weight kininogen to release bradykinin, and this reaction is inhibited by C1 inhibitor. PMID: 19342086
NPY3-35 is a new peptide generated by plasma kallikrein PMID: 19620246

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.