Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07952P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07952P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P01127
Target Symbol PDGFB
Synonyms Becaplermin; c sis; FLJ12858; Oncogene SIS; PDGF 2; PDGF B chain; PDGF Beta; PDGF subunit B; PDGF-2; PDGF2; Pdgfb; PDGFB_HUMAN; Platelet derived growth factor 2; Platelet derived growth factor B chain; Platelet derived growth factor beta; Platelet derived growth factor beta polypeptide (oncogene SIS); Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog); Platelet derived growth factor beta polypeptide; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor subunit B; Proto-oncogene c-Sis; Simian sarcoma viral (v sis) oncogene homolog; SIS; SSV; v sis platelet derived growth factor beta polypeptide
Species Homo sapiens (Human)
Expression System E.coli
Tag C-6His
Target Protein Sequence SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Expression Range 82-190aa
Protein Length Full Length of Mature Protein
Mol. Weight 14.3 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Subcellular Location Secreted. Note=Released by platelets upon wounding.
Protein Families PDGF/VEGF growth factor family
Database References
Associated Diseases Basal ganglia calcification, idiopathic, 5 (IBGC5)
Tissue Specificity Expressed at high levels in the heart, brain (sustantia nigra), placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus), skeletal muscle, kidney and lung.

Gene Functions References

  1. we identified two potential susceptibility loci for PC risk, which are located in PDGFB at 22q13.1 PMID: 29168174
  2. Treating HepG2 cells with hepatotoxicants resulted in a significant increase in mRNA expression of platelet-derived growth factor BB (PDGF-BB) and transforming growth factor beta (TGFbeta). PMID: 29558627
  3. The morphology and immunophenotype of all 6 cases was analogous to those with the canonical COL1A1-PDGFB fusion; none of the cases showed fibrosarcomatous transformation. This study illustrates that the COL6A3-PDGFD fusion product is rare in dermatofibrosarcoma protuberans, and associated with an apparent predilection for breast PMID: 30014607
  4. PDGF-B expression was found in ovarian tumor microvessels in 72% of cases. High expression of PDGF in pericapillary cells was strongly associated with high expression of this marker in cancer cells. Significant correlations between PDGF-B and nestin expression in malignant tumor microvessels were also found. PMID: 28397199
  5. SOX7 transcription factor mediates PDGF-BB-induced IL-33 expression. PMID: 27150562
  6. High expression of PDGF-BB may be involved in the pathogenesis of Graves' disease. CCR2-positive macrophages may induce the expression of PDGF-BB through HIF-1alpha signal. PMID: 29319128
  7. rhPDGF-BB promoted the proliferation of hADSCs via miR-363/PI3K/Akt pathway, indicating that rhPDGF-BB combined with ADSCs could treat Achilles tendinitis via miR-363/PI3K/Akt pathway. PMID: 28766166
  8. This study identifies the mbPDGF-BB in cell derived extracellular vesicles as a relevant mediator of diabetes-associated vascular smooth muscle cell resistance to apoptosis. PMID: 29386225
  9. This review showed that PDGFB was one of the common gene involved included with brain calcification. PMID: 28162874
  10. Rare Skin Tumor Dermatofibrosarcoma Protuberans (DFSP) is characterized by the translocation of the PDGFB gene to the collagen 1A1 gene. PMID: 28940884
  11. Transglutaminase type 2 affects cell migration through post-translational modification of PDGF-BB. PMID: 27633721
  12. PDGF-B rs1800818 polymorphism might play a role in mediating the susceptibility to severe fever with thrombocytopenia syndrome in Chinese individuals. PMID: 27147565
  13. PDAP-1 as an effecter of PDGF signaling in glioma cells PMID: 27448842
  14. High PDGFB expression is associated with gastric cancer. PMID: 28423550
  15. We observed that regenerating and necrotic muscle fibers in muscle biopsy samples from Duchenne muscular dystrophy patients expressed PDGF-BB. PMID: 28618254
  16. Elevated PDGFB expression was noted in 29% of patients with papillary renal cell carcinoma. PMID: 27989785
  17. high-throughput affinity plasma proteomic profiling is a valuable research strategy to identify potential candidate biomarkers for thrombosis-related disorders, and our study suggests a novel association of PDGFB plasma levels with venous thromboembolism. PMID: 27742707
  18. High PDGFB expression is associated with glioma. PMID: 26951930
  19. A cell-autonomous positive-signaling circuit is associated with the PDGF-NO-ID4-regulatory axis in glioblastoma cells. PMID: 28327358
  20. SphK1 is regulated by PDGF-BB in pulmonary artery smooth muscle cells via the transcription factor Egr-1, promoting cell proliferation. PMID: 27099350
  21. PDGF-BB regulates the proliferation and differentiation of human melanocytes in a differentiation-stage-specific manner. PMID: 27289338
  22. this study shows that the expression of PDGFB is significantly downregulated in keloid fibroblasts compared to normal human fibroblasts PMID: 27465069
  23. this study demonstrated that knockdown of SCARA5 inhibits PDGFBBinduced HASMC proliferation and migration through suppression of the PDGF signaling pathway. PMID: 27035566
  24. The simultaneous action of PDGF-B/PDGFRbeta and VEGF165b on the same type of receptor may explain the resistance to antiangiogenic therapy, which depends on the degree of modulation of PDGFRbeta phosphorylation. PMID: 27127135
  25. The expression of angiogenesis markers VEGF-A, VEGFR, PDGFbetabeta, PDGFR, CCND1 and CA9 was assessed by immunohistochemistry and correlated with overall survival and progression-free survival in patients with renal cell carcinoma undergoing therapy with Sunitinib, but no correlation was found between expression of angiogenesis markers and clinical outcome. PMID: 28011500
  26. ore than 65% of cases had PDGF-BB mRNA amplification, confirming immunohistochemical results. We herein validated PDGF-BB as a potential therapeutic and prognostic tool of ovarian cancer aggressiveness. PMID: 27807074
  27. Case Report: congenital atrophic dermatofibrosarcoma protuberans with COL1A1-PDGFB rearrangement. PMID: 26932148
  28. Placental endothelial cell-derived PDGF-BB recruits human placental multipotent mesenchymal stromal cells involved in vascular development via PDGFR-beta/STAT3 activation PMID: 26353894
  29. Suggest that PDGF-B signaling may play a role in endothelial and cardiomyocyte recovery from ischemia reperfusion injury after heart transplantation. PMID: 26371596
  30. Lessons from SLC20A2, PDGFB, and PDGFRB mutation carriers. Three causative genes have been identified: SLC20A2, PDGFRB and, recently, PDGFB, whose associated phenotype has not yet been extensively studied. PMID: 26129893
  31. loss-of-function mutations in PDGFB or PDGFRB cause Primary Familial Brain Calcification. PMID: 26599395
  32. Three factor model revealed significant gene-gene interaction for PDGFB +286A>G, PDGFB +1135A>C and HER2 Ile165Val SNPs with GBC. Protein-protein interaction showed significant association of PDGFB and HER2 with EGFR receptor signaling pathway. PMID: 26320430
  33. Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts. PMID: 26518873
  34. Electron microscopy structure of PDGFRB [a full-length human platelet-derived growth factor receptor], in complex with its ligand PDGF-B. PMID: 26463591
  35. TM expression in corneal epithelium was modulated during the corneal wound healing process, and may be regulated by PDGF-BB. In addition, rTMD23 has therapeutic potential in corneal injury PMID: 25816372
  36. Our results demonstrated that PDGF-B tumor growth and progression in clear cell renal cell carcinoma PMID: 25766258
  37. PDGFB and IL18R1 represent plausible candidates for studying the pathophysiology of these disorders in the context of TLR4 activation PMID: 25327457
  38. TAZ promotes neuroblastoma cell proliferation and tumorigenicity through up-regulating the expression of PDGF-beta genes. PMID: 25940705
  39. Phloretin inhibits PDGF-BB-induced thoracic aorta smooth muscle cell proliferation and migration. PMID: 25945863
  40. COL1A1-PDGFbeta translocation is specific to dermatofibrosarcoma protuberans. Platelet-derived growth factor may have acted in an autocrine manner to cause cell division, which may have led to the development of dermatofibrosarcoma protuberans PMID: 25924890
  41. the present study, demonstrated for the first time, to the best of our knowledge, that ligustrazine downregulated PDGF-BB-induced VSMC proliferation and migration partly, at least, through inhibiting the activation of the ERK and P38 MAPK signaling. PMID: 25738255
  42. cytoplasmic expression of VEGF, VEGFR2, PDGF-B, and PDGFR-beta in RCC tumour cells is different in various pathologic stage and cell type. Notably, VEGF and PDGF-B expression are higher in papillary than in clear cell renal cell carcinoma. PMID: 25550804
  43. COL1A1-PDGFB is a useful and accurate tool in diagnosing DFSP[ Dermatofibrosarcoma protuberans ] in Koreans. PMID: 25683993
  44. Significant diurnal variations in platelet counts and TGF-b1 and PDGF-BB levels were not observed in platelet-rich plasma. PMID: 24878758
  45. Report lowered PDGF-BB levels in acute pancreatitis and increased PDGF-BB levels in chronic pancreatitis. PMID: 25278706
  46. rhPDGF-BB delivery on a collagen scaffold enhanced cellular proliferation and angiogenesis during the early phase of healing after rotator cuff repair. PMID: 25349036
  47. The mutation of PDGFB cause primary familial brain calcifications. PMID: 25212438
  48. Gain of PDGFB is associated with response to therapy in metastatic renal cell carcinoma. PMID: 24524969
  49. These results suggest that PDGF-BB promotes pulmonary artery smooth muscle cells proliferation and survival, which is likely to be mediated via the JNK pathway. PMID: 24804810
  50. PDGFB hypomethylation is a favourable prognostic biomarker in primary myelofibrosis. PMID: 25498506

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Cytokines
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TGFB2.
Recombinant Human Transforming Growth Factor Beta-2 (TGFB2) Protein (His)
  • Molecule: TGFB2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His;
  • Sequence: Protein Fragment;
CAT#: BLC-11103P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Cd70 Antigen (CD70) Protein (His)
  • Molecule: CD70;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Extracellular Domain;
CAT#: BLC-10853P

Save $121
Sale
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL2.
Recombinant Human Interleukin-2 (IL2) Protein (GST)
  • Molecule: IL2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: GST;
  • Sequence: Full Length Protein;
CAT#: BLC-10775P

Save $49
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human C-C Motif Chemokine 18 (CCL18) Protein (His)
  • Molecule: CCL18;
  • Species: Human;
  • Expression system: Yeast;
  • Tag: His;
  • Sequence: Full Length Protein;
CAT#: BLC-08214P

Save $141
Sale
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Platelet-Derived Growth Factor Subunit B (PDGFB) Protein (His-SUMO)
  • Molecule: PDGFB;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: His-SUMO;
  • Sequence: Full Length Protein;
CAT#: BLC-07892P

Save $131
Sale
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase A (PPIA)
  • Molecule: PPIA;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: Tag-Free;
  • Sequence: Full Length Protein;
CAT#: BLC-07883P

Save $206
Recently viewed